Products

View as table Download

USD 98.00

USD 800.00

In Stock

DDX46 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DDX46 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DDX46 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

DDX46 (myc-DDK-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DDX46 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

DDX46 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

DDX46 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal Anti-DDX46 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the C terminal of human DDX46. Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Rabbit Polyclonal Anti-DDX46 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the middle region of human DDX46. Synthetic peptide located within the following region: LAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKV

DDX46 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

DDX46 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

DDX46 (untagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of DDX46 (NM_014829) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of DDX46 (NM_001300860) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of DDX46 (NM_014829) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of DDX46 (NM_014829) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of DDX46 (NM_001300860) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack