Germany
Japan
United Kingdom
China
DDX46 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DDX46 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DDX46 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DDX46 (myc-DDK-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DDX46 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DDX46 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
DDX46 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal Anti-DDX46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the C terminal of human DDX46. Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL |
Rabbit Polyclonal Anti-DDX46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the middle region of human DDX46. Synthetic peptide located within the following region: LAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKV |
DDX46 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
DDX46 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DDX46 (untagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of DDX46 (NM_014829) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DDX46 (NM_001300860) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DDX46 (NM_014829) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DDX46 (NM_014829) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of DDX46 (NM_001300860) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- DDX46
Pathways
- Spliceosome