Products

View as table Download

USD 98.00

USD 800.00

In Stock

DDX46 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Ddx46 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DDX46 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402320 is the updated version of KN202320.

Ddx46 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN504399 is the updated version of KN304399.

Ddx46 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Ddx46 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Ddx46 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Ddx46 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ddx46 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Ddx46 (mGFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ddx46 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Ddx46 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ddx46 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Ddx46 (mGFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ddx46 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Ddx46 (myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DDX46 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DDX46 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

DDX46 (myc-DDK-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DDX46 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Ddx46 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Ddx46 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ddx46 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Ddx46 (mGFP-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ddx46 (GFP-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

DDX46 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

DDX46 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal Anti-DDX46 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the C terminal of human DDX46. Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Rabbit Polyclonal Anti-DDX46 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the middle region of human DDX46. Synthetic peptide located within the following region: LAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKV

DDX46 CRISPRa kit - CRISPR gene activation of human DEAD-box helicase 46

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Ddx46 CRISPRa kit - CRISPR gene activation of mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene DDX46

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene DDX46

DDX46 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Ddx46 (untagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Ddx46 (untagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Ddx46 (untagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qSTAR qPCR primer pairs against Mus musculus gene Ddx46

DDX46 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Ddx46 (untagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

DDX46 (untagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

DDX46 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Ddx46 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Ddx46 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

DDX46 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DDX46

DDX46 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 682-1031 of human DDX46 (NP_055644.2).
Modifications Unmodified

Transient overexpression of DDX46 (NM_014829) in HEK293T cells paraffin embedded controls for ICC/IHC staining