Germany
Japan
United Kingdom
China
DDX46 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Ddx46 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DDX46 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402320 is the updated version of KN202320.
Ddx46 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504399 is the updated version of KN304399.
Ddx46 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ddx46 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ddx46 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ddx46 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx46 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ddx46 (mGFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx46 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ddx46 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx46 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ddx46 (mGFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx46 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ddx46 (myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DDX46 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DDX46 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DDX46 (myc-DDK-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DDX46 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ddx46 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ddx46 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx46 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ddx46 (mGFP-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx46 (GFP-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DDX46 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
DDX46 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal Anti-DDX46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the C terminal of human DDX46. Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL |
Rabbit Polyclonal Anti-DDX46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the middle region of human DDX46. Synthetic peptide located within the following region: LAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKV |
DDX46 CRISPRa kit - CRISPR gene activation of human DEAD-box helicase 46
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ddx46 CRISPRa kit - CRISPR gene activation of mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene DDX46
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene DDX46
DDX46 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Ddx46 (untagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (cDNA clone MGC:31579 IMAGE:4505095), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Ddx46 (untagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Ddx46 (untagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Ddx46
DDX46 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ddx46 (untagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (Ddx46), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
DDX46 (untagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 (DDX46), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
DDX46 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Ddx46 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Ddx46 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
DDX46 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDX46 |
DDX46 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 682-1031 of human DDX46 (NP_055644.2). |
| Modifications | Unmodified |
Transient overexpression of DDX46 (NM_014829) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- DDX46