Germany
Japan
United Kingdom
China
PRPF18 (Myc-DDK-tagged)-Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PRPF18 (Myc-DDK tagged) - Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PRPF18 (mGFP-tagged) - Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PRPF18 (GFP-tagged) - Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PRPF18 (untagged)-Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-PRPF18 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRPF18. |
PRPF18 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
(untagged)-Homo sapiens, pre-mRNA splicing factor similar to S. cerevisiae Prp18, clone MGC:1668 IMAGE:3160552, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PRPF18 (untagged)-Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PRPF18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPF18 antibody is: synthetic peptide directed towards the middle region of Human PRPF18. Synthetic peptide located within the following region: NKGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEEL |
PRPF18 MS Standard C13 and N15-labeled recombinant protein (NP_003666)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PRPF18 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of PRPF18 (NM_003675) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PRPF18 (NM_003675) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PRPF18 (NM_003675) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PRPF18
Pathways
- Spliceosome