Germany
Japan
United Kingdom
China
PRPF18 (Myc-DDK-tagged)-Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Prpf18 (Myc-DDK-tagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PRPF18 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN401556 is the updated version of KN201556.
Prpf18 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513965 is the updated version of KN313965.
Prpf18 (GFP-tagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Prpf18 (Myc-DDK-tagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prpf18 (Myc-DDK-tagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Prpf18 (mGFP-tagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prpf18 (GFP-tagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PRPF18 (Myc-DDK tagged) - Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PRPF18 (mGFP-tagged) - Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PRPF18 (GFP-tagged) - Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Prpf18 (Myc-DDK-tagged ORF) - Rat PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (Prpf18), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Prpf18 (Myc-DDK-tagged ORF) - Rat PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (Prpf18), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prpf18 (Myc-DDK-tagged ORF) - Rat PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (Prpf18), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Prpf18 (mGFP-tagged ORF) - Rat PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (Prpf18), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prpf18 (GFP-tagged ORF) - Rat PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (Prpf18), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PRPF18 (untagged)-Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-PRPF18 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRPF18. |
PRPF18 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
(untagged)-Homo sapiens, pre-mRNA splicing factor similar to S. cerevisiae Prp18, clone MGC:1668 IMAGE:3160552, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PRPF18 (untagged)-Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PRPF18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPF18 antibody is: synthetic peptide directed towards the middle region of Human PRPF18. Synthetic peptide located within the following region: NKGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEEL |
PRPF18 CRISPRa kit - CRISPR gene activation of human pre-mRNA processing factor 18
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Prpf18 CRISPRa kit - CRISPR gene activation of mouse pre-mRNA processing factor 18
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PRPF18
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PRPF18
Prpf18 (untagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Prpf18
PRPF18 MS Standard C13 and N15-labeled recombinant protein (NP_003666)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Prpf18 (untagged ORF) - Rat PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (Prpf18), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Prpf18 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Prpf18 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PRPF18 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PRPF18 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-342 of human PRPF18 (NP_003666.1). |
| Modifications | Unmodified |
Transient overexpression of PRPF18 (NM_003675) in HEK293T cells paraffin embedded controls for ICC/IHC staining
PRPF18 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
USD 1,395.00
5 Weeks
PRPF18 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Prpf18 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Prpf18 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Prpf18 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Prpf18 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse pre-mRNA processing factor 18 (Prpf18), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
PRPF18 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Prpf18 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Active filters
Target Symbol
- PRPF18