Products

View as table Download

Recombinant protein of human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)

Tag C-Myc/DDK
Expression Host HEK293T

Prpf18 (Myc-DDK-tagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRPF18 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN401556 is the updated version of KN201556.

Prpf18 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513965 is the updated version of KN313965.

Prpf18 (GFP-tagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Prpf18 (Myc-DDK-tagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Prpf18 (Myc-DDK-tagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Prpf18 (mGFP-tagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Prpf18 (GFP-tagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PRPF18 (Myc-DDK tagged) - Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PRPF18 (mGFP-tagged) - Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PRPF18 (GFP-tagged) - Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Prpf18 (Myc-DDK-tagged ORF) - Rat PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (Prpf18), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Prpf18 (Myc-DDK-tagged ORF) - Rat PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (Prpf18), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Prpf18 (Myc-DDK-tagged ORF) - Rat PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (Prpf18), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Prpf18 (mGFP-tagged ORF) - Rat PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (Prpf18), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Prpf18 (GFP-tagged ORF) - Rat PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (Prpf18), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PRPF18 (untagged)-Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-PRPF18 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRPF18.

PRPF18 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

(untagged)-Homo sapiens, pre-mRNA splicing factor similar to S. cerevisiae Prp18, clone MGC:1668 IMAGE:3160552, complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

PRPF18 (untagged)-Human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-PRPF18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPF18 antibody is: synthetic peptide directed towards the middle region of Human PRPF18. Synthetic peptide located within the following region: NKGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEEL

PRPF18 CRISPRa kit - CRISPR gene activation of human pre-mRNA processing factor 18

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Prpf18 CRISPRa kit - CRISPR gene activation of mouse pre-mRNA processing factor 18

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene PRPF18

Application Plasmid of exact quantity for transcript copy number calculation

Prpf18 (untagged) - Mouse PRP18 pre-mRNA processing factor 18 homolog (yeast) (Prpf18), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qSTAR qPCR primer pairs against Mus musculus gene Prpf18

PRPF18 MS Standard C13 and N15-labeled recombinant protein (NP_003666)

Tag C-Myc/DDK
Expression Host HEK293

Prpf18 (untagged ORF) - Rat PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (Prpf18), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

Prpf18 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Prpf18 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

PRPF18 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

PRPF18 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-342 of human PRPF18 (NP_003666.1).
Modifications Unmodified

Transient overexpression of PRPF18 (NM_003675) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Prpf18 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Prpf18 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Prpf18 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Prpf18 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Purified recombinant protein of Mouse pre-mRNA processing factor 18 (Prpf18), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Tag C-MYC/DDK
Expression Host HEK293T

PRPF18 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

Prpf18 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS