Products

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.

TJP1 (Myc-DDK-tagged)-Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, TJP1 (Myc-DDK tagged) - Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

TJP1 (GFP-tagged) - Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TJP1 (Myc-DDK-tagged)-Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TJP1 (myc-DDK-tagged) - Human tight junction protein 1 (TJP1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, TJP1 (Myc-DDK tagged) - Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

TJP1 (myc-DDK-tagged) - Human tight junction protein 1 (TJP1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TJP1 (GFP-tagged) - Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-TJP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS

Rabbit polyclonal antibody to ZO-1 (tight junction protein 1 (zona occludens 1))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 296 of ZO-1 (Uniprot ID#Q07157)

TJP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

TJP1 (untagged)-Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC127835 is the updated version of SC120780.

Rabbit Polyclonal Anti-ZO 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZO 1 Antibody: A synthesized peptide derived from human ZO 1

Goat Anti-ZO1 Tight Junction Protein Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PKPTSQNQFSEHDKT, from the internal region of the protein sequence according to NP_003248.3; NP_783297.2.

Rabbit anti ZO-1 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal antibody to ZO-1 (tight junction protein 1 (zona occludens 1))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1574 and 1748 of ZO-1 (Uniprot ID#Q07157)

TJP1 MS Standard C13 and N15-labeled recombinant protein (NP_783297)

Tag C-Myc/DDK
Expression Host HEK293

TJP1 MS Standard C13 and N15-labeled recombinant protein (NP_003248)

Tag C-Myc/DDK
Expression Host HEK293

TJP1 (GFP-tagged) - Human tight junction protein 1 (TJP1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TJP1 (GFP-tagged) - Human tight junction protein 1 (TJP1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TJP1 (untagged)-Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
SC309896 is the updated version of SC120781.

TJP1 (untagged)-Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

TJP1 (untagged) - Human tight junction protein 1 (TJP1), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

TJP1 (untagged) - Human tight junction protein 1 (TJP1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

USD 2,100.00

4 Weeks

Transient overexpression of TJP1 (NM_175610) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 2,490.00

4 Weeks

Transient overexpression of TJP1 (NM_003257) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 2,430.00

4 Weeks

Transient overexpression of TJP1 (NM_001301026) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 2,580.00

4 Weeks

Transient overexpression of TJP1 (NM_001301025) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of TJP1 (NM_175610) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of TJP1 (NM_175610) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of TJP1 (NM_003257) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of TJP1 (NM_003257) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of TJP1 (NM_001301026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of TJP1 (NM_001301026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of TJP1 (NM_001301025) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack