Products

Antibodies (15)
cDNA Clones (11)
Proteins (7)
Jump to Filters
View as table Download
Tyrosinase (TYR) (NM_000372) Human Tagged ORF Clone
RG221797

USD 530.00

In Stock

TYR (GFP-tagged) - Human tyrosinase (oculocutaneous albinism IA) (TYR)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tyrosinase (TYR) (NM_000372) Human Tagged ORF Clone
RC221797L3

USD 680.00

3 Weeks

Lenti ORF clone of Human tyrosinase (oculocutaneous albinism IA) (TYR), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tyrosinase (TYR) (NM_000372) Human Tagged ORF Clone
RC221797L4

USD 680.00

In Stock

Lenti ORF clone of Human tyrosinase (oculocutaneous albinism IA) (TYR), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tyrosinase (TYR) (BC027179) Human Untagged Clone
SC122223

USD 310.00

In Stock

TYR (untagged)-Human tyrosinase (oculocutaneous albinism IA) (cDNA clone MGC:9191 IMAGE:3923096), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Tyrosinase (TYR) (NM_000372) Human Untagged Clone
SC300059

USD 900.00

In Stock

TYR (untagged)-Human tyrosinase (oculocutaneous albinism IA) (TYR)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
Tyrosinase (TYR) (NM_000372) Human Over-expression Lysate
LY424756

USD 605.00

In Stock

Transient overexpression lysate of tyrosinase (oculocutaneous albinism IA) (TYR)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Tyrosinase (TYR) Rabbit Polyclonal Antibody
TA327028

USD 275.00

3 Weeks

TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TYR
Tyrosinase (TYR) (C-term) Rabbit Polyclonal Antibody
AP17815PU-N

USD 450.00

2 Weeks

Tyrosinase (TYR) (C-term) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 486-513 amino acids from the C-terminal region of Human Tyrosinase.
Tyrosinase (TYR) Rabbit Polyclonal Antibody
TA347501

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Tyrosinase Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Tyrosinase Antibody: A synthesized peptide derived from human Tyrosinase
Tyrosinase (TYR) (NM_000372) Human Over-expression Lysate
LC424756

USD 187.00

In Stock

TYR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Tyrosinase (TYR) (NM_000372) Human Tagged ORF Clone
RC221797L2

USD 680.00

3 Weeks

Lenti ORF clone of Human tyrosinase (oculocutaneous albinism IA) (TYR), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Tyrosinase (TYR) Rabbit Polyclonal Antibody
TA313342

USD 345.00

In Stock

Rabbit polyclonal Tyrosinase antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human tyrosinase.
Tyrosinase (TYR) Rabbit Polyclonal Antibody
TA335226

USD 310.00

5 Days

Rabbit Polyclonal Anti-TYR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYR antibody: synthetic peptide directed towards the middle region of human TYR. Synthetic peptide located within the following region: CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM
Tyrosinase (TYR) Mouse Monoclonal Antibody [Clone ID: OTI1F3]
CF801362

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TYR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Tyrosinase (TYR) (NM_000372) Human Mass Spec Standard
PH321797

USD 2,055.00

3 Weeks

TYR MS Standard C13 and N15-labeled recombinant protein (NP_000363)

Tag C-Myc/DDK
Expression Host HEK293
Tyrosinase (TYR) Rabbit Polyclonal Antibody
TA323679

USD 345.00

In Stock

Anti-TYR Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase
Tyrosinase (TYR) Rabbit Polyclonal Antibody
TA323680

USD 345.00

In Stock

Anti-TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase
Tyrosinase (TYR) Mouse Monoclonal Antibody [Clone ID: OTI1F3]
TA801362

USD 379.00

In Stock

TYR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Tyrosinase (TYR) Mouse Monoclonal Antibody [Clone ID: OTI1F3]
TA801362S

USD 159.00

2 Days

TYR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Tyrosinase (TYR) ICC Control Block
TB421797

USD 1,130.00

4 Weeks

Transient overexpression of TYR (NM_000372) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Tyrosinase (TYR) (NM_000372) Human Recombinant Protein
TP762332

USD 205.00

2 Weeks

Purified recombinant protein of Human tyrosinase (oculocutaneous albinism IA) (TYR), His19-Phe320, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
Tyrosinase (TYR) Cytosection
TS421797

USD 225.00

4 Weeks

Transient overexpression of TYR (NM_000372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Tyrosinase (TYR) Cytosection
TS421797P5

USD 889.00

4 Weeks

Transient overexpression of TYR (NM_000372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Tyrosinase (TYR) Mouse Monoclonal Antibody [Clone ID: UMAB257]
UM800147

USD 468.00

In Stock

TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Tyrosinase (TYR) Mouse Monoclonal Antibody [Clone ID: UMAB257]
UM800147CF

USD 528.00

In Stock

Carrier-free (BSA/glycerol-free) TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Tyrosinase (TYR) Mouse Monoclonal Antibody [Clone ID: UMAB257]
UM870147

USD 180.00

In Stock

TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated