Products

cDNA Clones (35)
Proteins (28)
Antibodies (5)
Jump to Filters
View as table Download
KCNMB3 (NM_171828) Human Tagged ORF Clone
RC217576

USD 420.00

In Stock

KCNMB3 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KCNMB3 (NM_171829) Human Tagged ORF Clone
RC217636

USD 420.00

In Stock

KCNMB3 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KCNMB3 (NM_171830) Human Tagged ORF Clone
RC222739

USD 420.00

In Stock

KCNMB3 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KCNMB3 (NM_014407) Human Tagged ORF Clone
RC224647

USD 420.00

In Stock

KCNMB3 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KCNMB3 (NM_001163677) Human Tagged ORF Clone
RC228110

USD 420.00

In Stock

KCNMB3 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KCNMB3 (NM_171828) Human Tagged ORF Clone
RG217576

USD 460.00

In Stock

KCNMB3 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMB3 (NM_014407) Human Tagged ORF Clone
RG224647

USD 460.00

In Stock

KCNMB3 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMB3 (NM_171828) Human Tagged ORF Clone
RC217576L3

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_171828) Human Tagged ORF Clone Lentiviral Particle
RC217576L3V

USD 820.00

6 Weeks

Lenti ORF particles, KCNMB3 (Myc-DDK tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_171828) Human Tagged ORF Clone
RC217576L4

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_171828) Human Tagged ORF Clone Lentiviral Particle
RC217576L4V

USD 820.00

6 Weeks

Lenti ORF particles, KCNMB3 (mGFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_171829) Human Tagged ORF Clone
RC217636L3

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_171829) Human Tagged ORF Clone Lentiviral Particle
RC217636L3V

USD 820.00

6 Weeks

Lenti ORF particles, KCNMB3 (Myc-DDK tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_171829) Human Tagged ORF Clone
RC217636L4

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_171829) Human Tagged ORF Clone Lentiviral Particle
RC217636L4V

USD 820.00

6 Weeks

Lenti ORF particles, KCNMB3 (mGFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_171830) Human Tagged ORF Clone
RC222739L3

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_171830) Human Tagged ORF Clone Lentiviral Particle
RC222739L3V

USD 820.00

6 Weeks

Lenti ORF particles, KCNMB3 (Myc-DDK tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_171830) Human Tagged ORF Clone
RC222739L4

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_171830) Human Tagged ORF Clone Lentiviral Particle
RC222739L4V

USD 820.00

6 Weeks

Lenti ORF particles, KCNMB3 (mGFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_014407) Human Tagged ORF Clone
RC224647L3

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_014407) Human Tagged ORF Clone Lentiviral Particle
RC224647L3V

USD 820.00

6 Weeks

Lenti ORF particles, KCNMB3 (Myc-DDK tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_014407) Human Tagged ORF Clone
RC224647L4

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_014407) Human Tagged ORF Clone Lentiviral Particle
RC224647L4V

USD 820.00

6 Weeks

Lenti ORF particles, KCNMB3 (mGFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_001163677) Human Tagged ORF Clone
RC228110L3

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 5, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_001163677) Human Tagged ORF Clone Lentiviral Particle
RC228110L3V

USD 820.00

6 Weeks

Lenti ORF particles, KCNMB3 (Myc-DDK tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_001163677) Human Tagged ORF Clone
RC228110L4

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 5, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_001163677) Human Tagged ORF Clone Lentiviral Particle
RC228110L4V

USD 820.00

6 Weeks

Lenti ORF particles, KCNMB3 (mGFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB3 (NM_171829) Human Tagged ORF Clone
RG217636

USD 460.00

3 Weeks

KCNMB3 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMB3 (NM_171830) Human Tagged ORF Clone
RG222739

USD 460.00

3 Weeks

KCNMB3 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMB3 (NM_001163677) Human Tagged ORF Clone
RG228110

USD 460.00

3 Weeks

KCNMB3 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMB3 (NM_171829) Human Untagged Clone
SC123933

USD 420.00

In Stock

KCNMB3 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
KCNMB3 (NM_171828) Human Over-expression Lysate
LC406784

USD 121.00

In Stock

KCNMB3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB3 (NM_001163677) Human Over-expression Lysate
LC431138

USD 121.00

In Stock

KCNMB3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB3 (NM_171828) Human Untagged Clone
SC123922

USD 660.00

In Stock

KCNMB3 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
KCNMB3 (NM_171828) Human Recombinant Protein
TP762004

USD 215.00

In Stock

Purified recombinant protein of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 1,Gln87-Gln205, with N-terminal His-Trx tag, expressed in E. coli, 50ug

Tag N-His-Trx
Expression Host E. coli
KCNMB3 (NM_171829) Human Over-expression Lysate
LY406785

USD 396.00

5 Days

Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB3 Rabbit Polyclonal Antibody
TA317679

USD 425.00

5 Days

KCNMB3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Gorilla
Immunogen KCNMB3 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human KCNMB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (87%); Marmoset (80%).
KCNMB3 Rabbit Polyclonal Antibody
TA317908

USD 425.00

5 Days

KCNMB3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human
Immunogen KCNMB3 antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNMB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Bovine, Bat, Horse (88%); Gibbon, Dog, Pig (82%).
KCNMB3 Mouse Monoclonal Antibody [Clone ID: S40B-18]
TA326402

USD 410.00

5 Days

Mouse monoclonal BK Beta3a Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
KCNMB3 Rabbit Polyclonal Antibody
TA338746

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMB3 antibody: synthetic peptide directed towards the middle region of human KCNMB3. Synthetic peptide located within the following region: SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC
KCNMB3 (82-207, His-tag) Human Protein
AR51621PU-N

USD 845.00

2 Weeks

KCNMB3 (82-207, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
KCNMB3 (82-207, His-tag) Human Protein
AR51621PU-S

USD 330.00

2 Weeks

KCNMB3 (82-207, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
KCNMB3 (NM_171829) Human Over-expression Lysate
LC406785

USD 121.00

2 Weeks

KCNMB3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB3 (NM_171830) Human Over-expression Lysate
LC406786

USD 121.00

2 Weeks

KCNMB3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB3 (NM_014407) Human Over-expression Lysate
LC415300

USD 121.00

2 Weeks

KCNMB3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB3 (NM_171828) Human Over-expression Lysate
LY406784

USD 396.00

5 Days

Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB3 (NM_171830) Human Over-expression Lysate
LY406786

USD 396.00

5 Days

Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB3 (NM_014407) Human Over-expression Lysate
LY415300

USD 396.00

5 Days

Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB3 (NM_001163677) Human Over-expression Lysate
LY431138

USD 396.00

5 Days

Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 5

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB3 (NM_014407) Human Untagged Clone
SC123923

USD 660.00

4 Weeks

KCNMB3 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 4

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC123923 is the updated version of SC123934.