Products

cDNA Clones (28)
Proteins (17)
Antibodies (9)
Jump to Filters
View as table Download
Casein Kinase 1 alpha (CSNK1A1) (NM_001892) Human Tagged ORF Clone Lentiviral Particle
RC201797L3V

USD 820.00

7 Weeks

Lenti ORF particles, CSNK1A1 (Myc-DDK tagged) - Human casein kinase 1, alpha 1 (CSNK1A1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Casein Kinase 1 alpha (CSNK1A1) (NM_001892) Human Tagged ORF Clone Lentiviral Particle
RC201797L4V

USD 820.00

7 Weeks

Lenti ORF particles, CSNK1A1 (mGFP-tagged) - Human casein kinase 1, alpha 1 (CSNK1A1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Casein Kinase 1 alpha (CSNK1A1) (NM_001025105) Human Tagged ORF Clone Lentiviral Particle
RC217936L3V

USD 820.00

7 Weeks

Lenti ORF particles, CSNK1A1 (Myc-DDK tagged) - Human casein kinase 1, alpha 1 (CSNK1A1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Casein Kinase 1 alpha (CSNK1A1) (NM_001025105) Human Tagged ORF Clone Lentiviral Particle
RC217936L4V

USD 820.00

7 Weeks

Lenti ORF particles, CSNK1A1 (mGFP-tagged) - Human casein kinase 1, alpha 1 (CSNK1A1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Casein Kinase 1 alpha (CSNK1A1) (NM_001271742) Human Tagged ORF Clone
RC233621

USD 420.00

3 Weeks

CSNK1A1 (Myc-DDK tagged) - Homo sapiens casein kinase 1, alpha 1 (CSNK1A1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Casein Kinase 1 alpha (CSNK1A1) (NM_001271741) Human Tagged ORF Clone
RC233767

USD 420.00

2 Weeks

CSNK1A1 (Myc-DDK tagged) - Homo sapiens casein kinase 1, alpha 1 (CSNK1A1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Casein Kinase 1 alpha (CSNK1A1) (NM_001892) Human Tagged ORF Clone
RG201797

USD 460.00

3 Weeks

CSNK1A1 (GFP-tagged) - Human casein kinase 1, alpha 1 (CSNK1A1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Casein Kinase 1 alpha (CSNK1A1) (NM_001271742) Human Tagged ORF Clone
RG233621

USD 460.00

3 Weeks

CSNK1A1 (GFP-tagged) - Homo sapiens casein kinase 1, alpha 1 (CSNK1A1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Casein Kinase 1 alpha (CSNK1A1) (NM_001271741) Human Tagged ORF Clone
RG233767

USD 460.00

3 Weeks

CSNK1A1 (GFP-tagged) - Homo sapiens casein kinase 1, alpha 1 (CSNK1A1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Casein Kinase 1 alpha (CSNK1A1) (NM_001892) Human Untagged Clone
SC118967

USD 310.00

In Stock

CSNK1A1 (untagged)-Human casein kinase 1, alpha 1 (CSNK1A1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Casein Kinase 1 alpha (CSNK1A1) Rabbit Polyclonal Antibody
TA313698

USD 345.00

In Stock

Rabbit polyclonal anti-CKI-a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a.
Casein Kinase 1 alpha (CSNK1A1) Rabbit Polyclonal Antibody
TA313699

USD 345.00

In Stock

Rabbit polyclonal CK-1a (Tyr294) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CK-1a around the phosphorylation site of tyrosine 294 (Y-D-YP-T-F).
Modifications Phospho-specific
Casein Kinase 1 alpha (CSNK1A1) Rabbit Polyclonal Antibody
AP20367PU-N

USD 407.00

2 Weeks

Casein Kinase 1 alpha (CSNK1A1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Casein Kinase 1 alpha (CSNK1A1) (NM_001892) Human Tagged ORF Clone
RC201797L2

USD 620.00

3 Weeks

Lenti ORF clone of Human casein kinase 1, alpha 1 (CSNK1A1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Casein Kinase 1 alpha (CSNK1A1) (NM_001892) Human Untagged Clone
SC323470

USD 760.00

In Stock

CSNK1A1 (untagged)-Kinase deficient mutant (K46M) of Human casein kinase 1, alpha 1 (CSNK1A1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Casein Kinase 1 alpha (CSNK1A1) (NM_001892) Human Over-expression Lysate
LC419689

USD 121.00

In Stock

CSNK1A1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Casein Kinase 1 alpha (CSNK1A1) (NM_001892) Human Over-expression Lysate
LY419689

USD 396.00

In Stock

Transient overexpression lysate of casein kinase 1, alpha 1 (CSNK1A1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Casein Kinase 1 alpha (CSNK1A1) (NM_001025105) Human Over-expression Lysate
LY422590

USD 396.00

4 Weeks

Transient overexpression lysate of casein kinase 1, alpha 1 (CSNK1A1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Casein Kinase 1 alpha (CSNK1A1) Rabbit Polyclonal Antibody
TA313700

USD 345.00

4 Weeks

Rabbit polyclonal Casein Kinase I a (Ab-321) antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Casein Kinase I a around the phosphorylation site of threonine 321 (A-Q-TP-P-T).
Casein Kinase 1 alpha (CSNK1A1) (NM_001025105) Human Recombinant Protein
TP761718

USD 215.00

In Stock

Purified recombinant protein of Human casein kinase 1, alpha 1 (CSNK1A1), transcript variant 1, full length, with N-terminal His tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
Casein Kinase 1 alpha (CSNK1A1) Rabbit Polyclonal Antibody
TA339970

USD 375.00

5 Days

Rabbit Polyclonal Anti-CSNK1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1A1 antibody: synthetic peptide directed towards the C terminal of human CSNK1A1. Synthetic peptide located within the following region: HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
CSNK1A1 (1-337, His-tag) Human Protein
AR51430PU-N

USD 845.00

2 Weeks

CSNK1A1 (1-337, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
CSNK1A1 (1-337, His-tag) Human Protein
AR51430PU-S

USD 330.00

2 Weeks

CSNK1A1 (1-337, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Casein Kinase 1 alpha (CSNK1A1) Rabbit Polyclonal Antibody
TA323098

USD 345.00

In Stock

Anti-CSNK1A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 316-329 amino acids of Human Casein kinase I isoform alpha
Casein Kinase 1 alpha (CSNK1A1) ICC Control Block
TB401797

USD 1,070.00

4 Weeks

Transient overexpression of CSNK1A1 (NM_001892) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Casein Kinase 1 alpha (CSNK1A1) ICC Control Block
TB417936

USD 1,070.00

4 Weeks

Transient overexpression of CSNK1A1 (NM_001025105) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Casein Kinase 1 alpha (CSNK1A1) ICC Control Block
TB433621

USD 1,070.00

4 Weeks

Transient overexpression of CSNK1A1 (NM_001271742) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Casein Kinase 1 alpha (CSNK1A1) ICC Control Block
TB433767

USD 1,070.00

4 Weeks

Transient overexpression of CSNK1A1 (NM_001271741) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Casein Kinase 1 alpha (CSNK1A1) Cytosection
TS401797

USD 225.00

4 Weeks

Transient overexpression of CSNK1A1 (NM_001892) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Casein Kinase 1 alpha (CSNK1A1) Cytosection
TS401797P5

USD 889.00

4 Weeks

Transient overexpression of CSNK1A1 (NM_001892) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack