Products

View as table Download

NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, NFAT5 (Myc-DDK tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, NFAT5 (mGFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NFAT5 (Myc-DDK tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NFAT5 (mGFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

NFAT5 (Myc-DDK tagged) - Homo sapiens nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

NFAT5 (GFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NFAT5 (GFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NFAT5 (GFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NFAT5 (GFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NFAT5 (GFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NFAT5 (GFP-tagged) - Homo sapiens nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti-ORF clone of NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-NFAT5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFAT5 antibody: synthetic peptide directed towards the middle region of human NFAT5. Synthetic peptide located within the following region: PGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGN

Transient overexpression lysate of nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti-ORF clone of NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

NFAT5 (untagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

NFAT5 (untagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal NFAT5/TonEBP (Ser155) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NFAT5/TonEBP around the phosphorylation site of serine 155 (D-N-SP-R-M).
Modifications Phospho-specific

NFAT5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

NFAT5 (untagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4

Vector pCMV6 series
Tag Tag Free

NFAT5 (untagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3

Vector pCMV6 series
Tag Tag Free

NFAT5 (untagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2

Vector pCMV6 series
Tag Tag Free

NFAT5 (untagged) - Homo sapiens nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 5

Vector pCMV6 series
Tag Tag Free