ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, ASL (Myc-DDK tagged) - Human argininosuccinate lyase (ASL), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, ASL (mGFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ASL (GFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ASL (GFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human argininosuccinate lyase (ASL), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, ASL (Myc-DDK tagged) - Human argininosuccinate lyase (ASL), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human argininosuccinate lyase (ASL), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, ASL (mGFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human argininosuccinate lyase (ASL), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ASL (Myc-DDK tagged) - Human argininosuccinate lyase (ASL), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human argininosuccinate lyase (ASL), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ASL (mGFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ASL (mGFP-tagged)-Human argininosuccinate lyase (ASL), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ASL (mGFP-tagged)-Human argininosuccinate lyase (ASL), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ASL (mGFP-tagged)-Human argininosuccinate lyase (ASL), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ASL (mGFP-tagged)-Human argininosuccinate lyase (ASL), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ASL (GFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ASL (GFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ASL (untagged)-Human argininosuccinate lyase (ASL), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ASL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ASL antibody: synthetic peptide directed towards the middle region of human ASL. Synthetic peptide located within the following region: LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK |
USD 396.00
In Stock
Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal antibody to Argininosuccinate Lyase (argininosuccinate lyase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 13 and 261 of ASL (Uniprot ID#P04424) |
Rabbit Polyclonal Anti-ASL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ASL antibody: synthetic peptide directed towards the N terminal of human ASL. Synthetic peptide located within the following region: GATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAE |
Rabbit Polyclonal antibody to ASL (argininosuccinate lyase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 86 and 325 of ASL |
ASL HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human argininosuccinate lyase (ASL), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
ASL (untagged)-Human argininosuccinate lyase (ASL), transcript variant 4
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 121.00
In Stock
ASL HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 187.00
In Stock
ASL HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 187.00
In Stock
ASL HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 605.00
In Stock
Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 605.00
In Stock
Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 4
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Arginosuccinase (1-464, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Arginosuccinase (1-464, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ASL mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ASL mouse monoclonal antibody,clone OTI9G2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ASL mouse monoclonal antibody, clone OTI14C7 (formerly 14C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ASL MS Standard C13 and N15-labeled recombinant protein (NP_001020114)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ASL MS Standard C13 and N15-labeled recombinant protein (NP_000039)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ASL (untagged)-Human argininosuccinate lyase (ASL), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |