ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human asparagine synthetase (ASNS), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, ASNS (Myc-DDK tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, ASNS (mGFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human asparagine synthetase (ASNS), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
ASNS (GFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ASNS (GFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ASNS (GFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ASNS (Myc-DDK tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ASNS (mGFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ASNS (Myc-DDK tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ASNS (mGFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, ASNS (Myc-DDK tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, ASNS (mGFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 5
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 850.00
6 Weeks
Lenti ORF particles, ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ASNS (mGFP-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 5
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 850.00
6 Weeks
Lenti ORF particles, ASNS (mGFP-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 6
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 850.00
6 Weeks
Lenti ORF particles, ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ASNS (mGFP-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 6
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 850.00
6 Weeks
Lenti ORF particles, ASNS (mGFP-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 990.00
11 Weeks
Lenti ORF particles, ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ASNS (mGFP-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 990.00
11 Weeks
Lenti ORF particles, ASNS (mGFP-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ASNS (GFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ASNS (GFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ASNS (GFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit anti-ASNS Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ASNS |
ASNS (untagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ASNS HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
ASNS (untagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
ASNS (untagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 3
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ASNS Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ASNS antibody: synthetic peptide directed towards the C terminal of human ASNS. Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ASNS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ASNS mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |