Products

cDNA Clones (19)
Proteins (6)
Antibodies (3)
Jump to Filters
View as table Download
PCCB (NM_000532) Human Tagged ORF Clone Lentiviral Particle
RC202019L1V

USD 880.00

3 Weeks

Lenti ORF particles, PCCB (Myc-DDK tagged) - Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PCCB (NM_000532) Human Tagged ORF Clone Lentiviral Particle
RC202019L2V

USD 880.00

6 Weeks

Lenti ORF particles, PCCB (mGFP-tagged) - Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PCCB (NM_000532) Human Tagged ORF Clone
RC202019

USD 480.00

In Stock

PCCB (Myc-DDK-tagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCCB (NM_000532) Human Tagged ORF Clone
RG202019

USD 530.00

In Stock

PCCB (GFP-tagged) - Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PCCB (NM_001178014) Human Tagged ORF Clone
RC230275

USD 480.00

In Stock

PCCB (Myc-DDK-tagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCCB (NM_000532) Human Tagged ORF Clone
RC202019L3

USD 680.00

3 Weeks

Lenti ORF clone of Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_000532) Human Tagged ORF Clone Lentiviral Particle
RC202019L3V

USD 880.00

5 Weeks

Lenti ORF particles, PCCB (Myc-DDK tagged) - Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_000532) Human Tagged ORF Clone
RC202019L4

USD 680.00

3 Weeks

Lenti ORF clone of Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_000532) Human Tagged ORF Clone Lentiviral Particle
RC202019L4V

USD 880.00

7 Weeks

Lenti ORF particles, PCCB (mGFP-tagged) - Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_001178014) Human Tagged ORF Clone
RC230275L3

USD 680.00

3 Weeks

Lenti-ORF clone of PCCB (Myc-DDK-tagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_001178014) Human Tagged ORF Clone Lentiviral Particle
RC230275L3V

USD 880.00

6 Weeks

Lenti ORF particles, PCCB (Myc-DDK-tagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_001178014) Human Tagged ORF Clone
RC230275L4

USD 680.00

3 Weeks

Lenti-ORF clone of PCCB (mGFP-tagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_001178014) Human Tagged ORF Clone Lentiviral Particle
RC230275L4V

USD 880.00

6 Weeks

Lenti ORF particles, PCCB (mGFP-tagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_001178014) Human Tagged ORF Clone
RG230275

USD 530.00

3 Weeks

PCCB (GFP-tagged) - Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PCCB Rabbit Polyclonal Antibody
TA308402

USD 415.00

2 Weeks

Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166)
PCCB (NM_000532) Human Tagged ORF Clone
RC202019L1

USD 840.00

In Stock

Lenti ORF clone of Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PCCB Rabbit Polyclonal Antibody
TA332679

USD 275.00

3 Weeks

Rabbit anti-PCCB Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PCCB
PCCB (NM_000532) Human Tagged ORF Clone
RC202019L2

USD 680.00

3 Weeks

Lenti ORF clone of Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PCCB (NM_000532) Human Untagged Clone
SC119822

USD 760.00

In Stock

PCCB (untagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PCCB (NM_000532) Human Untagged Clone
SC323905

USD 760.00

In Stock

PCCB (untagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PCCB Rabbit Polyclonal Antibody
TA335153

USD 375.00

5 Days

Rabbit polyclonal Anti-PCCB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCCB antibody: synthetic peptide directed towards the middle region of human PCCB. Synthetic peptide located within the following region: PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS
PCCB (NM_001178014) Human Untagged Clone
SC328913

USD 950.00

3 Weeks

PCCB (untagged)-Human propionyl CoA carboxylase beta polypeptide (PCCB) nuclear gene encoding mitochondrial protein transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PCCB ICC Control Block
TB402019

USD 1,130.00

4 Weeks

Transient overexpression of PCCB (NM_000532) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PCCB ICC Control Block
TB430275

USD 1,130.00

4 Weeks

Transient overexpression of PCCB (NM_001178014) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PCCB Cytosection
TS402019

USD 225.00

4 Weeks

Transient overexpression of PCCB (NM_000532) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PCCB Cytosection
TS402019P5

USD 889.00

4 Weeks

Transient overexpression of PCCB (NM_000532) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PCCB Cytosection
TS430275

USD 225.00

4 Weeks

Transient overexpression of PCCB (NM_001178014) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PCCB Cytosection
TS430275P5

USD 889.00

4 Weeks

Transient overexpression of PCCB (NM_001178014) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack