Products

cDNA Clones (33)
RNAi (12)
Gene Expression (7)
Proteins (6)
Antibodies (5)
Jump to Filters
View as table Download
PCCB (NM_000532) Human Tagged ORF Clone Lentiviral Particle
RC202019L1V

USD 880.00

3 Weeks

Lenti ORF particles, PCCB (Myc-DDK tagged) - Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PCCB (NM_000532) Human Tagged ORF Clone Lentiviral Particle
RC202019L2V

USD 880.00

6 Weeks

Lenti ORF particles, PCCB (mGFP-tagged) - Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Pccb (NM_025835) Mouse Tagged ORF Clone
MG208651

USD 550.00

In Stock

Pccb (GFP-tagged) - Mouse propionyl Coenzyme A carboxylase, beta polypeptide (Pccb)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PCCB (NM_000532) Human Tagged ORF Clone
RC202019

USD 480.00

In Stock

PCCB (Myc-DDK-tagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCCB (NM_000532) Human Tagged ORF Clone
RG202019

USD 530.00

In Stock

PCCB (GFP-tagged) - Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pccb (NM_025835) Mouse Tagged ORF Clone
MR208651

USD 500.00

In Stock

Pccb (Myc-DDK-tagged) - Mouse propionyl Coenzyme A carboxylase, beta polypeptide (Pccb), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCCB (NM_001178014) Human Tagged ORF Clone
RC230275

USD 480.00

In Stock

PCCB (Myc-DDK-tagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCCB Human Gene Knockout Kit (CRISPR)
KN402019

USD 1,290.00

2 Weeks

PCCB - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402019 is the updated version of KN202019.
Pccb Mouse Gene Knockout Kit (CRISPR)
KN512873

USD 1,290.00

2 Weeks

Pccb - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN512873 is the updated version of KN312873.
Pccb (NM_025835) Mouse Tagged ORF Clone
MR208651L3

USD 700.00

3 Weeks

Lenti ORF clone of Pccb (Myc-DDK-tagged) - Mouse propionyl Coenzyme A carboxylase, beta polypeptide (Pccb), nuclear gene encoding mitochondrial protein

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pccb (NM_025835) Mouse Tagged ORF Clone Lentiviral Particle
MR208651L3V

USD 900.00

6 Weeks

Lenti ORF particles, Pccb (Myc-DDK-tagged) - Mouse propionyl Coenzyme A carboxylase, beta polypeptide (Pccb), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pccb (NM_025835) Mouse Tagged ORF Clone
MR208651L4

USD 700.00

3 Weeks

Lenti ORF clone of Pccb (mGFP-tagged) - Mouse propionyl Coenzyme A carboxylase, beta polypeptide (Pccb), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pccb (NM_025835) Mouse Tagged ORF Clone Lentiviral Particle
MR208651L4V

USD 900.00

6 Weeks

Lenti ORF particles, Pccb (GFP-tagged) - Mouse propionyl Coenzyme A carboxylase, beta polypeptide (Pccb), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_000532) Human Tagged ORF Clone
RC202019L3

USD 680.00

3 Weeks

Lenti ORF clone of Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_000532) Human Tagged ORF Clone Lentiviral Particle
RC202019L3V

USD 880.00

5 Weeks

Lenti ORF particles, PCCB (Myc-DDK tagged) - Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_000532) Human Tagged ORF Clone
RC202019L4

USD 680.00

3 Weeks

Lenti ORF clone of Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_000532) Human Tagged ORF Clone Lentiviral Particle
RC202019L4V

USD 880.00

7 Weeks

Lenti ORF particles, PCCB (mGFP-tagged) - Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_001178014) Human Tagged ORF Clone
RC230275L3

USD 680.00

3 Weeks

Lenti-ORF clone of PCCB (Myc-DDK-tagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_001178014) Human Tagged ORF Clone Lentiviral Particle
RC230275L3V

USD 880.00

6 Weeks

Lenti ORF particles, PCCB (Myc-DDK-tagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_001178014) Human Tagged ORF Clone
RC230275L4

USD 680.00

3 Weeks

Lenti-ORF clone of PCCB (mGFP-tagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_001178014) Human Tagged ORF Clone Lentiviral Particle
RC230275L4V

USD 880.00

6 Weeks

Lenti ORF particles, PCCB (mGFP-tagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB (NM_001178014) Human Tagged ORF Clone
RG230275

USD 530.00

3 Weeks

PCCB (GFP-tagged) - Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pccb (NM_017030) Rat Tagged ORF Clone
RR201083

USD 730.00

5 Weeks

Pccb (Myc-DDK-tagged ORF) - Rat propionyl coenzyme A carboxylase, beta polypeptide (Pccb), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pccb (NM_017030) Rat Tagged ORF Clone
RR201083L3

USD 930.00

8 Weeks

Lenti ORF clone of Pccb (Myc-DDK-tagged ORF) - Rat propionyl coenzyme A carboxylase, beta polypeptide (Pccb), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pccb (NM_017030) Rat Tagged ORF Clone Lentiviral Particle
RR201083L3V

USD 1,140.00

12 Weeks

Lenti ORF particles, Pccb (Myc-DDK-tagged ORF) - Rat propionyl coenzyme A carboxylase, beta polypeptide (Pccb), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pccb (NM_017030) Rat Tagged ORF Clone
RR201083L4

USD 1,020.00

8 Weeks

Lenti ORF clone of Pccb (mGFP-tagged ORF) - Rat propionyl coenzyme A carboxylase, beta polypeptide (Pccb), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pccb (NM_017030) Rat Tagged ORF Clone Lentiviral Particle
RR201083L4V

USD 1,280.00

12 Weeks

Lenti ORF particles, Pccb (GFP-tagged ORF) - Rat propionyl coenzyme A carboxylase, beta polypeptide (Pccb), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCCB Rabbit Polyclonal Antibody
TA308402

USD 415.00

2 Weeks

Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166)
PCCB (NM_000532) Human Tagged ORF Clone
RC202019L1

USD 840.00

In Stock

Lenti ORF clone of Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PCCB Rabbit Polyclonal Antibody
TA332679

USD 275.00

3 Weeks

Rabbit anti-PCCB Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PCCB
PCCB (NM_000532) Human Tagged ORF Clone
RC202019L2

USD 680.00

3 Weeks

Lenti ORF clone of Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PCCB (NM_000532) Human Untagged Clone
SC119822

USD 760.00

In Stock

PCCB (untagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Pccb (NM_025835) Mouse Untagged Clone
MC205562

USD 210.00

In Stock

Pccb (untagged) - Mouse propionyl Coenzyme A carboxylase, beta polypeptide (Pccb), nuclear gene encoding mitochondrial protein, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
PCCB (NM_000532) Human Untagged Clone
SC323905

USD 760.00

In Stock

PCCB (untagged)-Human propionyl CoA carboxylase, beta polypeptide (PCCB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PCCB (NM_000532) Human 3' UTR Clone
SC201539

USD 560.00

2 Weeks

3`UTR clone of propionyl Coenzyme A carboxylase beta polypeptide (PCCB) nuclear gene encoding mitochondrial protein for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
PCCB Rabbit Polyclonal Antibody
TA335153

USD 375.00

5 Days

Rabbit polyclonal Anti-PCCB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCCB antibody: synthetic peptide directed towards the middle region of human PCCB. Synthetic peptide located within the following region: PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS
Human PCCB activation kit by CRISPRa
GA103407

USD 1,290.00

2 Weeks

PCCB CRISPRa kit - CRISPR gene activation of human propionyl-CoA carboxylase subunit beta

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Pccb activation kit by CRISPRa
GA207017

USD 1,290.00

2 Weeks

Pccb CRISPRa kit - CRISPR gene activation of mouse propionyl Coenzyme A carboxylase, beta polypeptide

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
PCCB Human qPCR Primer Pair (NM_000532)
HP200504

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PCCB

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Pccb Mouse qPCR Template Standard (NM_025835)
MK204710

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Pccb

Application Plasmid of exact quantity for transcript copy number calculation
Pccb Mouse qPCR Primer Pair (NM_025835)
MP211798

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Pccb

Pccb (NM_017030) Rat Untagged Clone
RN201083

USD 730.00

4 Weeks

Pccb (untagged ORF) - Rat propionyl coenzyme A carboxylase, beta polypeptide (Pccb), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PCCB (NM_001178014) Human Untagged Clone
SC328913

USD 950.00

3 Weeks

PCCB (untagged)-Human propionyl CoA carboxylase beta polypeptide (PCCB) nuclear gene encoding mitochondrial protein transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PCCB Human siRNA Oligo Duplex (Locus ID 5096)
SR303375

USD 430.00

2 Weeks

PCCB (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Pccb Mouse siRNA Oligo Duplex (Locus ID 66904)
SR417017

USD 430.00

2 Weeks

Pccb (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Pccb Rat siRNA Oligo Duplex (Locus ID 24624)
SR500797

USD 430.00

2 Weeks

Pccb (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

PCCB Rabbit Polyclonal Antibody
TA366707

USD 380.00

4 Weeks

PCCB rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PCCB
PCCB Rabbit Polyclonal Antibody
TA371059

USD 380.00

4 Weeks

PCCB rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PCCB
PCCB ICC Control Block
TB402019

USD 1,130.00

4 Weeks

Transient overexpression of PCCB (NM_000532) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PCCB ICC Control Block
TB430275

USD 1,130.00

4 Weeks

Transient overexpression of PCCB (NM_001178014) in HEK293T cells paraffin embedded controls for ICC/IHC staining