Products

cDNA Clones (13)
Proteins (7)
Antibodies (3)
Jump to Filters
View as table Download
SESN1 (NM_014454) Human Tagged ORF Clone
RC211305

USD 500.00

In Stock

SESN1 (Myc-DDK-tagged)-Human sestrin 1 (SESN1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SESN1 (NM_014454) Human Tagged ORF Clone
RG211305

USD 550.00

In Stock

SESN1 (GFP-tagged) - Human sestrin 1 (SESN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SESN1 (NM_001199933) Human Tagged ORF Clone
RG232847

USD 460.00

2 Weeks

SESN1 (GFP-tagged) - Homo sapiens sestrin 1 (SESN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SESN1 (NM_014454) Human Tagged ORF Clone
RC211305L3

USD 700.00

3 Weeks

Lenti-ORF clone of SESN1 (Myc-DDK-tagged)-Human sestrin 1 (SESN1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SESN1 (NM_014454) Human Tagged ORF Clone
RC211305L4

USD 700.00

3 Weeks

Lenti-ORF clone of SESN1 (mGFP-tagged)-Human sestrin 1 (SESN1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SESN1 (NM_014454) Human Tagged ORF Clone Lentiviral Particle
RC211305L4V

USD 900.00

6 Weeks

Lenti ORF particles, SESN1 (mGFP-tagged)-Human sestrin 1 (SESN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SESN1 (NM_001199934) Human Tagged ORF Clone
RC232701

USD 420.00

3 Weeks

SESN1 (Myc-DDK tagged) - Homo sapiens sestrin 1 (SESN1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SESN1 (NM_001199933) Human Tagged ORF Clone
RC232847

USD 420.00

3 Weeks

SESN1 (Myc-DDK tagged) - Homo sapiens sestrin 1 (SESN1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SESN1 (NM_001199934) Human Tagged ORF Clone
RG232701

USD 460.00

3 Weeks

SESN1 (GFP-tagged) - Homo sapiens sestrin 1 (SESN1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SESN1 (NM_014454) Human Untagged Clone
SC127795

USD 930.00

In Stock

SESN1 (untagged)-Human sestrin 1 (SESN1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SESN1 Rabbit Polyclonal Antibody
TA315375

USD 345.00

In Stock

Rabbit polyclonal anti-SESN1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SESN1.
SESN1 Rabbit Polyclonal Antibody
TA334538

USD 375.00

5 Days

Rabbit Polyclonal Anti-SESN1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SESN1 antibody is: synthetic peptide directed towards the middle region of Human SESN1. Synthetic peptide located within the following region: KWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAE
SESN1 (NM_001199933) Human Untagged Clone
SC329595

USD 490.00

3 Weeks

SESN1 (untagged) - Homo sapiens sestrin 1 (SESN1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
SESN1 (NM_001199934) Human Untagged Clone
SC329596

USD 420.00

3 Weeks

SESN1 (untagged) - Homo sapiens sestrin 1 (SESN1), transcript variant 3

Vector pCMV6 series
Tag Tag Free
SESN1 Rabbit Polyclonal Antibody
TA351658

USD 345.00

In Stock

Rabbit Polyclonal Anti-SESN1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SESN1
SESN1 (NM_014454) ICC Control Block
TB411305

USD 1,150.00

4 Weeks

Transient overexpression of SESN1 (NM_014454) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SESN1 (NM_001199934) ICC Control Block
TB432701

USD 1,070.00

4 Weeks

Transient overexpression of SESN1 (NM_001199934) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SESN1 (NM_001199933) ICC Control Block
TB432847

USD 1,070.00

4 Weeks

Transient overexpression of SESN1 (NM_001199933) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SESN1 Cytosection
TS411305

USD 225.00

4 Weeks

Transient overexpression of SESN1 (NM_014454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SESN1 Cytosection
TS411305P5

USD 889.00

4 Weeks

Transient overexpression of SESN1 (NM_014454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SESN1 ICC Control Sections
TS432701P5

USD 889.00

4 Weeks

Transient overexpression of SESN1 (NM_001199934) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SESN1 ICC Control Sections
TS432847P5

USD 889.00

4 Weeks

Transient overexpression of SESN1 (NM_001199933) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack