Products

cDNA Clones (33)
RNAi (13)
Gene Expression (8)
Proteins (7)
Antibodies (6)
Jump to Filters
View as table Download
SESN1 (NM_014454) Human Tagged ORF Clone
RC211305

USD 500.00

In Stock

SESN1 (Myc-DDK-tagged)-Human sestrin 1 (SESN1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Sesn1 (NM_001013370) Mouse Tagged ORF Clone
MR207897

USD 350.00

In Stock

Sesn1 (Myc-DDK-tagged) - Mouse sestrin 1 (Sesn1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SESN1 (NM_014454) Human Tagged ORF Clone
RG211305

USD 550.00

In Stock

SESN1 (GFP-tagged) - Human sestrin 1 (SESN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SESN1 (NM_001199933) Human Tagged ORF Clone
RG232847

USD 460.00

2 Weeks

SESN1 (GFP-tagged) - Homo sapiens sestrin 1 (SESN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SESN1 Human Gene Knockout Kit (CRISPR)
KN411305

USD 1,290.00

2 Weeks

SESN1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN411305 is the updated version of KN211305.
Sesn1 Mouse Gene Knockout Kit (CRISPR)
KN515617

USD 1,290.00

2 Weeks

Sesn1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN515617 is the updated version of KN315617.
Sesn1 (NM_001013370) Mouse Tagged ORF Clone
MG207897

USD 390.00

3 Weeks

Sesn1 (GFP-tagged) - Mouse sestrin 1 (Sesn1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Sesn1 (NM_001162908) Mouse Tagged ORF Clone
MG216541

USD 640.00

3 Weeks

Sesn1 (GFP-tagged) - Mouse sestrin 1 (Sesn1) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Sesn1 (NM_001013370) Mouse Tagged ORF Clone
MR207897L3

USD 550.00

3 Weeks

Lenti ORF clone of Sesn1 (Myc-DDK-tagged) - Mouse sestrin 1 (Sesn1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Sesn1 (NM_001013370) Mouse Tagged ORF Clone
MR207897L4

USD 550.00

3 Weeks

Lenti ORF clone of Sesn1 (mGFP-tagged) - Mouse sestrin 1 (Sesn1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Sesn1 (NM_001162908) Mouse Tagged ORF Clone
MR216541

USD 580.00

4 Weeks

Sesn1 (Myc-DDK-tagged) - Mouse sestrin 1 (Sesn1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Sesn1 (NM_001162908) Mouse Tagged ORF Clone
MR216541L3

USD 780.00

4 Weeks

Lenti ORF clone of Sesn1 (Myc-DDK-tagged) - Mouse sestrin 1 (Sesn1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Sesn1 (NM_001162908) Mouse Tagged ORF Clone
MR216541L4

USD 780.00

4 Weeks

Lenti ORF clone of Sesn1 (mGFP-tagged) - Mouse sestrin 1 (Sesn1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SESN1 (NM_014454) Human Tagged ORF Clone
RC211305L3

USD 700.00

3 Weeks

Lenti-ORF clone of SESN1 (Myc-DDK-tagged)-Human sestrin 1 (SESN1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SESN1 (NM_014454) Human Tagged ORF Clone
RC211305L4

USD 700.00

3 Weeks

Lenti-ORF clone of SESN1 (mGFP-tagged)-Human sestrin 1 (SESN1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SESN1 (NM_014454) Human Tagged ORF Clone Lentiviral Particle
RC211305L4V

USD 900.00

6 Weeks

Lenti ORF particles, SESN1 (mGFP-tagged)-Human sestrin 1 (SESN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SESN1 (NM_001199934) Human Tagged ORF Clone
RC232701

USD 420.00

3 Weeks

SESN1 (Myc-DDK tagged) - Homo sapiens sestrin 1 (SESN1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SESN1 (NM_001199933) Human Tagged ORF Clone
RC232847

USD 420.00

3 Weeks

SESN1 (Myc-DDK tagged) - Homo sapiens sestrin 1 (SESN1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SESN1 (NM_001199934) Human Tagged ORF Clone
RG232701

USD 460.00

3 Weeks

SESN1 (GFP-tagged) - Homo sapiens sestrin 1 (SESN1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Sesn1 (NM_001106396) Rat Tagged ORF Clone
RR207621

USD 630.00

4 Weeks

Sesn1 (Myc-DDK-tagged ORF) - Rat sestrin 1 (Sesn1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Sesn1 (NM_001106396) Rat Tagged ORF Clone
RR207621L3

USD 820.00

9 Weeks

Lenti ORF clone of Sesn1 (Myc-DDK-tagged ORF) - Rat sestrin 1 (Sesn1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Sesn1 (NM_001106396) Rat Tagged ORF Clone
RR207621L4

USD 910.00

9 Weeks

Lenti ORF clone of Sesn1 (mGFP-tagged ORF) - Rat sestrin 1 (Sesn1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SESN1 (NM_014454) Human Untagged Clone
SC127795

USD 930.00

In Stock

SESN1 (untagged)-Human sestrin 1 (SESN1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SESN1 Human siRNA Oligo Duplex (Locus ID 27244)
SR309047

USD 430.00

In Stock

SESN1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Sesn1 (NM_001013370) Mouse Untagged Clone
MC203553

USD 210.00

In Stock

Sesn1 (untagged) - Mouse sestrin 1 (Sesn1), transcript variant 2, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
SESN1 Rabbit Polyclonal Antibody
TA315375

USD 345.00

In Stock

Rabbit polyclonal anti-SESN1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SESN1.
SESN1 Human shRNA Plasmid Kit (Locus ID 27244)
TG309517

USD 715.00

In Stock

SESN1 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
Sesn1 Mouse shRNA Plasmid (Locus ID 140742)
TG506032

USD 715.00

In Stock

Sesn1 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
SESN1 Human qPCR Primer Pair (NM_014454)
HP210900

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene SESN1

SESN1 (NM_014454) Human 3' UTR Clone
SC212558

USD 560.00

4 Weeks

3`UTR clone of sestrin 1 (SESN1) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
SESN1 Rabbit Polyclonal Antibody
TA334538

USD 375.00

5 Days

Rabbit Polyclonal Anti-SESN1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SESN1 antibody is: synthetic peptide directed towards the middle region of Human SESN1. Synthetic peptide located within the following region: KWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAE
Human SESN1 activation kit by CRISPRa
GA109080

USD 1,290.00

2 Weeks

SESN1 CRISPRa kit - CRISPR gene activation of human sestrin 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Sesn1 activation kit by CRISPRa
GA212532

USD 1,290.00

2 Weeks

Sesn1 CRISPRa kit - CRISPR gene activation of mouse sestrin 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
SESN1 Human qPCR Template Standard (NM_014454)
HK210213

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene SESN1

Application Plasmid of exact quantity for transcript copy number calculation
Sesn1 Mouse qPCR Template Standard (NM_001013370)
MK202954

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Sesn1

Application Plasmid of exact quantity for transcript copy number calculation
Sesn1 Mouse qPCR Primer Pair (NM_001013370)
MP215307

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Sesn1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Sesn1 (NM_001106396) Rat Untagged Clone
RN207621

USD 630.00

5 Weeks

Sesn1 (untagged ORF) - Rat sestrin 1 (Sesn1), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SESN1 (NM_001199933) Human Untagged Clone
SC329595

USD 490.00

3 Weeks

SESN1 (untagged) - Homo sapiens sestrin 1 (SESN1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
SESN1 (NM_001199934) Human Untagged Clone
SC329596

USD 420.00

3 Weeks

SESN1 (untagged) - Homo sapiens sestrin 1 (SESN1), transcript variant 3

Vector pCMV6 series
Tag Tag Free
Sesn1 Mouse siRNA Oligo Duplex (Locus ID 140742)
SR415846

USD 430.00

2 Weeks

Sesn1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

SESN1 Rabbit Polyclonal Antibody
TA351658

USD 345.00

In Stock

Rabbit Polyclonal Anti-SESN1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SESN1
Sesn1 Rabbit Polyclonal Antibody
TA357216

USD 360.00

5 Days

Sesn1 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
SESN1 Rabbit Polyclonal Antibody
TA361432

USD 360.00

5 Days

SESN1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SESN1