Products

View as table Download

CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, CBS (mGFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Recombinant protein of human cystathionine-beta-synthase (CBS)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, CBS (Myc-DDK tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CBS (mGFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

CBS (GFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CBS (GFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, CBS (Myc-DDK tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of CBS (mGFP-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CBS (mGFP-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of CBS (mGFP-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CBS (mGFP-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CBS (GFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human cystathionine-beta-synthase (CBS), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)

Applications IF, IHC, IP, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520)

Lenti ORF clone of Human cystathionine-beta-synthase (CBS), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit anti-CBS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CBS

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

CBS (untagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

CBSL mouse monoclonal antibody, clone 3E1, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human, Rat

CBSL mouse monoclonal antibody, clone 6B8, Purified

Applications ELISA, IHC, WB
Reactivities Human

CBSL mouse monoclonal antibody, clone 6A9, Purified

Applications ELISA, IHC, WB
Reactivities Human

CBSL mouse monoclonal antibody, clone 5F7, Purified

Applications ELISA, IHC, WB
Reactivities Human

CBS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF clone of Human cystathionine-beta-synthase (CBS), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CBS (untagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

CBSL rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CBS

CBS MS Standard C13 and N15-labeled recombinant protein (NP_000062)

Tag C-Myc/DDK
Expression Host HEK293

CBS (untagged)-Human cystathionine-beta-synthase (CBS) transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

CBS (untagged)-Human cystathionine-beta-synthase (CBS) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CBS

USD 1,070.00

4 Weeks

Transient overexpression of CBS (NM_000071) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of CBS (NM_001178008) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of CBS (NM_001178009) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CBS (NM_000071) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CBS (NM_000071) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CBS (NM_001178008) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CBS (NM_001178009) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack