Products

View as table Download

Goat Anti-HMGA1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-LASKQEKDGTEK, from the internal region of the protein sequence according to NP_665906.1; NP_665908.1; NP_002122.1; NP_665909.1; NP_665912.1; NP_665910.1.

HMGA1 (9-21) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Immunogen HMGA1 antibody was raised against peptide from the internal region (near N Terminus) of human HMGA1.

Rabbit polyclonal HMGA1 Antibody (C-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HMGA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 64-93 amino acids from the C-terminal region of human HMGA1.

HMGA1 (12-23) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bat, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Immunogen HMGA1 antibody was raised against synthetic peptide from an internal region of human HMGA1.

Goat Anti-HMGA1 (aa9-21) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SQPLASKQEKDGT, from the internal region (near N Terminus) of the protein sequence according to NP_665906.1; NP_002122.1.

Rabbit Polyclonal Anti-HMGA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HMGA1 Antibody: synthetic peptide directed towards the N terminal of human HMGA1. Synthetic peptide located within the following region: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRP

Rabbit Polyclonal Anti-Hmga1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Hmga1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hmga1. Synthetic peptide located within the following region: MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSE

Anti-HMGA1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1

Anti-HMGA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1

HMGA1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMGA1

HMGA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA1 (NP_665908.1).
Modifications Unmodified

HMGA1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA1 (NP_665908.1).
Modifications Unmodified

HMGA1 Rabbit monoclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated