Germany
Japan
United Kingdom
China
ATG5 (Myc-DDK-tagged)-Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ATG5 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Atg5 (Myc-DDK-tagged) - Mouse autophagy-related 5 (yeast) (Atg5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, ATG5 (Myc-DDK tagged) - Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ATG5 (mGFP-tagged) - Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ATG5 (myc-DDK-tagged) - Human autophagy related 5 (ATG5), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATG5 (GFP-tagged) - Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Atg5 (GFP-tagged) - Mouse autophagy-related 5 (yeast) (Atg5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATG5 (myc-DDK-tagged) - Human autophagy related 5 (ATG5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATG5 (untagged)-Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ATG5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN410563 is the updated version of KN210563.
Atg5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN501740 is the updated version of KN301740.
Lenti ORF particles, Atg5 (Myc-DDK-tagged) - Mouse autophagy-related 5 (yeast) (Atg5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Atg5 (mGFP-tagged) - Mouse autophagy-related 5 (yeast) (Atg5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Atg5 (GFP-tagged) - Mouse autophagy-related 5 (yeast) (Atg5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, ATG5 (Myc-DDK tagged) - Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, ATG5 (mGFP-tagged) - Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ATG5 (myc-DDK-tagged) - Human autophagy related 5 (ATG5), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATG5 (myc-DDK-tagged) - Human autophagy related 5 (ATG5), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Atg5 (Myc-DDK-tagged ORF) - Rat ATG5 autophagy related 5 homolog (S. cerevisiae) (Atg5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Atg5 (Myc-DDK-tagged ORF) - Rat ATG5 autophagy related 5 homolog (S. cerevisiae) (Atg5), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Atg5 (Myc-DDK-tagged ORF) - Rat ATG5 autophagy related 5 homolog (S. cerevisiae) (Atg5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Atg5 (mGFP-tagged ORF) - Rat ATG5 autophagy related 5 homolog (S. cerevisiae) (Atg5), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Atg5 (GFP-tagged ORF) - Rat ATG5 autophagy related 5 homolog (S. cerevisiae) (Atg5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Atg5 (untagged) - Mouse autophagy-related 5 (yeast) (Atg5), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Atg5 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Atg5 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Atg5 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
ATG5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR322789 is the updated version of SR306286.
ATG5 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
ATG5 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Lenti ORF clone of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ATG5 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Transient overexpression lysate of ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Atg5 (Myc-DDK-tagged) - Mouse autophagy-related 5 (yeast) (Atg5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Atg5 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
ATG5 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
qSTAR qPCR primer pairs against Mus musculus gene Atg5
ATG5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal ATG5 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ATG5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ATG5. |
Rabbit Polyclonal Anti-ATG5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG5 Antibody: synthetic peptide directed towards the C terminal of human ATG5. Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
Atg5 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Active filters
Target Symbol
- ATG5