Germany
Japan
United Kingdom
China
BCL2L2 (Myc-DDK-tagged)-Human BCL2-like 2 (BCL2L2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, BCL2L2 (Myc-DDK tagged) - Human BCL2-like 2 (BCL2L2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, BCL2L2 (mGFP-tagged) - Human BCL2-like 2 (BCL2L2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Bcl2l2 (Myc-DDK-tagged) - Mouse BCL2-like 2 (Bcl2l2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Bcl2l2 (Myc-DDK-tagged) - Mouse Bcl2-like 2 (cDNA clone MGC:25286 IMAGE:4511215)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BCL2L2 (Myc-DDK tagged) - Homo sapiens BCL2-like 2 (BCL2L2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BCL2L2 (GFP-tagged) - Human BCL2-like 2 (BCL2L2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BCL2L2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN411152 is the updated version of KN211152.
Bcl2l2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN502108 is the updated version of KN302108.
Bcl2l2 (GFP-tagged) - Mouse Bcl2-like 2 (cDNA clone MGC:25286 IMAGE:4511215)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Bcl2l2 (GFP-tagged) - Mouse BCL2-like 2 (Bcl2l2), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Bcl2l2 (Myc-DDK-tagged) - Mouse Bcl2-like 2 (cDNA clone MGC:25286 IMAGE:4511215)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bcl2l2 (Myc-DDK-tagged) - Mouse Bcl2-like 2 (cDNA clone MGC:25286 IMAGE:4511215), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Bcl2l2 (mGFP-tagged) - Mouse Bcl2-like 2 (cDNA clone MGC:25286 IMAGE:4511215)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bcl2l2 (GFP-tagged) - Mouse Bcl2-like 2 (cDNA clone MGC:25286 IMAGE:4511215), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Bcl2l2 (Myc-DDK-tagged) - Mouse BCL2-like 2 (Bcl2l2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bcl2l2 (Myc-DDK-tagged) - Mouse BCL2-like 2 (Bcl2l2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Bcl2l2 (mGFP-tagged) - Mouse BCL2-like 2 (Bcl2l2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bcl2l2 (GFP-tagged) - Mouse BCL2-like 2 (Bcl2l2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human BCL2-like 2 (BCL2L2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BCL2L2 (Myc-DDK tagged) - Human BCL2-like 2 (BCL2L2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human BCL2-like 2 (BCL2L2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BCL2L2 (mGFP-tagged) - Human BCL2-like 2 (BCL2L2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
BCL2L2 (myc-DDK-tagged) - Human BCL2L2-PABPN1 readthrough (BCL2L2-PABPN1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BCL2L2 (GFP-tagged) - Homo sapiens BCL2-like 2 (BCL2L2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Bcl2l2 (Myc-DDK-tagged ORF) - Rat Bcl2-like 2 (Bcl2l2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Bcl2l2 (Myc-DDK-tagged ORF) - Rat Bcl2-like 2 (Bcl2l2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bcl2l2 (Myc-DDK-tagged ORF) - Rat Bcl2-like 2 (Bcl2l2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Bcl2l2 (mGFP-tagged ORF) - Rat Bcl2-like 2 (Bcl2l2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bcl2l2 (GFP-tagged ORF) - Rat Bcl2-like 2 (Bcl2l2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Antibody against BCL2L2
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Bcl antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-59 amino acids from human Bcl. |
Lenti ORF clone of Human BCL2-like 2 (BCL2L2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit anti-BCL2L2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BCL2L2 |
Bcl2l2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
BCL2L2 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Lenti ORF clone of Human BCL2-like 2 (BCL2L2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
BCL2L2 (untagged)-Human BCL2-like 2 (BCL2L2), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC310637 is the updated version of SC117597.
BCL2L2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR319460 is the updated version of SR300414.
BCL2L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of BCL2-like 2 (BCL2L2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Bcl2l2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
qSTAR qPCR primer pairs against Homo sapiens gene BCL2L2
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit Polyclonal anti-Bcl2l2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Bcl2l2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Bcl2l2. Synthetic peptide located within the following region: VQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR |
Rabbit anti BCL-w Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of human BCL-W protein. This sequence is identical among human, rat and mouse origins. |
Bcl-2-like 2 (1-172, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Bcl-2-like 2 (1-172, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
BCL2L2 CRISPRa kit - CRISPR gene activation of human BCL2 like 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene BCL2L2
| Application | Plasmid of exact quantity for transcript copy number calculation |
Active filters
Target Symbol
- BCL2L2