Products

View as table Download

CALY (Myc-DDK-tagged)-Human calcyon neuron-specific vesicular protein (CALY)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human calcyon neuron-specific vesicular protein (CALY)

Tag C-Myc/DDK
Expression Host HEK293T

USD 68.00

USD 149.00

In Stock

Caly (Myc-DDK-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant A

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Caly (Myc-DDK-tagged ORF) - Rat calcyon neuron-specific vesicular protein (Caly), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Caly (Myc-DDK-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant B

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Caly (myc-DDK-tagged) - Rat calcyon neuron-specific vesicular protein (Caly), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CALY - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN407894 is the updated version of KN207894.

Caly - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN502473 is the updated version of KN302473.

Caly (GFP-tagged) - Mouse dopamine receptor D1 interacting protein (Drd1ip)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Caly (GFP-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly) transcript variant B, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Caly (GFP-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly) transcript variant A, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Caly (Myc-DDK-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant C

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Caly (Myc-DDK-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant C

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Caly (Myc-DDK-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant C, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Caly (mGFP-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant C

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Caly (GFP-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant C, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Caly (Myc-DDK-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant B

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Caly (Myc-DDK-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Caly (mGFP-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant B

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Caly (GFP-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Caly (Myc-DDK-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant A

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Caly (Myc-DDK-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Caly (mGFP-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant A

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Caly (GFP-tagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human calcyon neuron-specific vesicular protein (CALY), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human calcyon neuron-specific vesicular protein (CALY), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CALY (GFP-tagged) - Human calcyon neuron-specific vesicular protein (CALY)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Caly (Myc-DDK-tagged ORF) - Rat calcyon neuron-specific vesicular protein (Caly), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Caly (Myc-DDK-tagged ORF) - Rat calcyon neuron-specific vesicular protein (Caly), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Caly (mGFP-tagged ORF) - Rat calcyon neuron-specific vesicular protein (Caly), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Caly (GFP-tagged ORF) - Rat calcyon neuron-specific vesicular protein (Caly), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Caly - Rat, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS

Caly (untagged) - Mouse calcyon neuron-specific vesicular protein (Caly), transcript variant A, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

CALY (untagged)-Human calcyon neuron-specific vesicular protein (CALY)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

CALY (untagged)-Human calcyon neuron-specific vesicular protein (CALY)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-Caly Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Caly antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RHRSILAAIGAYPLSRKHGTEMPAIWGNSYRAGKEEHKGTTPAAMTVSTA

Caly - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

CALY CRISPRa kit - CRISPR gene activation of human calcyon neuron specific vesicular protein

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Caly CRISPRa kit - CRISPR gene activation of mouse calcyon neuron-specific vesicular protein

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene CALY

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene CALY

CALY HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

qPCR primer pairs and template standards against Mus musculus gene Drd1ip

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Mus musculus gene Caly

CALY MS Standard C13 and N15-labeled recombinant protein (NP_056537)

Tag C-Myc/DDK
Expression Host HEK293

Caly (untagged ORF) - Rat calcyon neuron-specific vesicular protein (Caly), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Caly (untagged) - Rat calcyon neuron-specific vesicular protein (Caly), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin