Products

cDNA Clones (31)
Proteins (23)
Antibodies (11)
Gene Expression (5)
RNAi (4)
Assay Kits (1)
Jump to Filters
View as table Download
Liver Carboxylesterase 1 (CES1) (NM_001025194) Human Recombinant Protein
TP302081

USD 867.00

In Stock

Recombinant protein of human carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Ces1g Mouse Gene Knockout Kit (CRISPR)
KN503193

USD 1,290.00

2 Weeks

Ces1g - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN503193 is the updated version of KN303193.
Liver Carboxylesterase 1 (CES1) (NM_001025194) Human Tagged ORF Clone Lentiviral Particle
RC202081L3V

USD 880.00

5 Weeks

Lenti ORF particles, CES1 (Myc-DDK tagged) - Human carboxylesterase 1 (CES1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Liver Carboxylesterase 1 (CES1) (NM_001025194) Human Tagged ORF Clone Lentiviral Particle
RC202081L4V

USD 880.00

7 Weeks

Lenti ORF particles, CES1 (mGFP-tagged) - Human carboxylesterase 1 (CES1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Liver Carboxylesterase 1 (CES1) (NM_001266) Human Tagged ORF Clone Lentiviral Particle
RC220398L3V

USD 880.00

6 Weeks

Lenti ORF particles, CES1 (Myc-DDK tagged) - Human carboxylesterase 1 (CES1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Liver Carboxylesterase 1 (CES1) (NM_001266) Human Tagged ORF Clone Lentiviral Particle
RC220398L4V

USD 880.00

6 Weeks

Lenti ORF particles, CES1 (mGFP-tagged) - Human carboxylesterase 1 (CES1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Liver Carboxylesterase 1 (CES1) (NM_001025195) Human Tagged ORF Clone Lentiviral Particle
RC220445L3V

USD 820.00

6 Weeks

Lenti ORF particles, CES1 (Myc-DDK-tagged)-Human carboxylesterase 1 (CES1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Liver Carboxylesterase 1 (CES1) (NM_001025195) Human Tagged ORF Clone Lentiviral Particle
RC220445L4V

USD 820.00

6 Weeks

Lenti ORF particles, CES1 (mGFP-tagged)-Human carboxylesterase 1 (CES1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LOC100736962 Rabbit Polyclonal Antibody
AP21252AF-N

USD 240.00

2 Weeks

LOC100736962 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Immunogen Esterase is isolated and purified from Porcine liver.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
LOC100736962 Rabbit Polyclonal Antibody
AP21252BT-N

USD 410.00

2 Weeks

LOC100736962 rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Conjugation Biotin
Immunogen Esterase is isolated and purified from Porcine liver.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
LOC100736962 Rabbit Polyclonal Antibody
AP21252PU-N

USD 550.00

2 Weeks

LOC100736962 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Immunogen Esterase is isolated and purified from Porcine liver.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Liver Carboxylesterase 1 (CES1) Goat Polyclonal Antibody
TA302448

USD 375.00

2 Weeks

Goat Polyclonal Antibody against CES1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NTQAAQKLKDKE, from the internal region (near C terminus) of the protein sequence according to NP_001020366.1; NP_001020365.1; NP_001257.4.
Liver Carboxylesterase 1 (CES1) Rabbit Polyclonal Antibody
TA346258

USD 410.00

5 Days

Rabbit Polyclonal Anti-CES1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES1 antibody: synthetic peptide directed towards the N terminal of human CES1. Synthetic peptide located within the following region: VLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATS
LOC100736962 Rabbit Polyclonal Antibody
R1079

USD 1,380.00

3 Days

LOC100736962 rabbit polyclonal antibody, Serum

Applications ELISA, WB
Reactivities Porcine
Immunogen Esterase from Porcine Liver.
Liver Carboxylesterase 1 (CES1) Rabbit Polyclonal Antibody
TA327200

USD 275.00

3 Weeks

Rabbit anti-CES1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CES1
Liver Carboxylesterase 1 (CES1) Rabbit Polyclonal Antibody
TA346259

USD 410.00

5 Days

Rabbit Polyclonal Anti-CES1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES1 antibody: synthetic peptide directed towards the C terminal of human CES1. Synthetic peptide located within the following region: ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL
Liver Carboxylesterase 1 (CES1) Human qPCR Template Standard (NM_001025194)
HK208675

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene CES1

Application Plasmid of exact quantity for transcript copy number calculation
Liver Carboxylesterase 1 (CES1) (NM_001025195) Human Over-expression Lysate
LY422600

USD 605.00

In Stock

Transient overexpression lysate of carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

CES1 Human shRNA Plasmid Kit (Locus ID 1066)
TR313972

USD 715.00

In Stock

CES1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
Liver Carboxylesterase 1 (CES1) (NM_001025194) Human Over-expression Lysate
LY422599

USD 396.00

5 Days

Transient overexpression lysate of carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LOC100736962 Rabbit Polyclonal Antibody
R1079HRPS

USD 540.00

3 Days

LOC100736962 rabbit polyclonal antibody, HRP, Purified

Applications ELISA, WB
Reactivities Porcine
Conjugation HRP
Immunogen Esterase from porcine liver
CES1 Human siRNA Oligo Duplex (Locus ID 1066)
SR300770

USD 430.00

In Stock

CES1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Liver Carboxylesterase 1 (CES1) Human qPCR Template Standard (NM_001266)
HK201919

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene CES1

Application Plasmid of exact quantity for transcript copy number calculation
Liver Carboxylesterase 1 (CES1) Human qPCR Primer Pair (NM_001266)
HP231082

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene CES1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
CES1 Human shRNA Plasmid Kit (Locus ID 1066)
TL313972

USD 815.00

2 Weeks

CES1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
Human Liver Carboxylesterase 1 (CES1) ELISA KIT (1 x 96 wells)
EA102550

USD 470.00

3 Weeks

For quantitative detection of human CES1 in cell culture supernates, serum and plasma (heparin, EDTA).

Assay Type Sandwich ELISA kit of Quantitative Detection for Human CES1
Format 8x12 divisible strips
Reactivities Human
Human Liver Carboxylesterase 1 (CES1) activation kit by CRISPRa
GA100768

USD 1,290.00

2 Weeks

CES1 CRISPRa kit - CRISPR gene activation of human carboxylesterase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector