Germany
Japan
United Kingdom
China
CYP2A6 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily A, polypeptide 6 (CYP2A6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CYP2A6 (GFP-tagged) - Human cytochrome P450, family 2, subfamily A, polypeptide 6 (CYP2A6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytochrome P450, family 2, subfamily A, polypeptide 6 (CYP2A6), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CYP2A6 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily A, polypeptide 6 (CYP2A6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 2, subfamily A, polypeptide 6 (CYP2A6), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CYP2A6 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily A, polypeptide 6 (CYP2A6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CYP2A6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of cytochrome P450, family 2, subfamily A, polypeptide 6 (CYP2A6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CYP2A6 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
CYP2A6 (untagged)-Human cytochrome P450, family 2, subfamily A, polypeptide 6 (CYP2A6)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC120818 is the updated version of SC119672.
Rabbit anti-CYP2A6 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CYP2A6 |
Rabbit polyclonal Cytochrome P450 2A6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Cytochrome P450 2A6. |
Cytochrome P450 2A6 (CYP2A6) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide, corresponding to amino acids 101-150 of Human CYP2A6. |
Rabbit Polyclonal Anti-CYP2A6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2A6 antibody is: synthetic peptide directed towards the C-terminal region of Human CYP2A6. Synthetic peptide located within the following region: MEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRD |
USD 1,140.00
9 Weeks
CYP2A6 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
qPCR primer pairs and template standards against Homo sapiens gene CYP2A6
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CYP2A6
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit Polyclonal Anti-CYP2A6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2A6 antibody: synthetic peptide directed towards the C terminal of human CYP2A6. Synthetic peptide located within the following region: AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKH |
Sheep polyclonal anti-Cytochrome P450 2A6 antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYP 2A6 |
USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Cytochrome P450 2A6 Clone RP1.2B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CYP2A6 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
4 Weeks
CYP2A6 CRISPRa kit - CRISPR gene activation of human cytochrome P450 family 2 subfamily A member 6
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
CYP2A6 MS Standard C13 and N15-labeled recombinant protein (NP_000753)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
3`UTR clone of cytochrome P450 family 2 subfamily A polypeptide 6 (CYP2A6) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Cytochrome P450 2A6/7/13 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from the Internal region of human CYP2A6/7/13. |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
5 Days
USD 420.00
5 Days
USD 159.00
In Stock
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- CYP2A6