Germany
Japan
United Kingdom
China
IDI1 (Myc-DDK-tagged)-Human isopentenyl-diphosphate delta isomerase 1 (IDI1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, IDI1 (Myc-DDK tagged) - Human isopentenyl-diphosphate delta isomerase 1 (IDI1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, IDI1 (mGFP-tagged) - Human isopentenyl-diphosphate delta isomerase 1 (IDI1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Idi1 (Myc-DDK-tagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IDI1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN414341 is the updated version of KN214341.
Idi1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508088 is the updated version of KN308088.
Idi1 (GFP-tagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Idi1 (GFP-tagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Idi1 (Myc-DDK-tagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Idi1 (Myc-DDK-tagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Idi1 (mGFP-tagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Idi1 (GFP-tagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Idi1 (Myc-DDK-tagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Idi1 (Myc-DDK-tagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Idi1 (Myc-DDK-tagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Idi1 (mGFP-tagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Idi1 (GFP-tagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human isopentenyl-diphosphate delta isomerase 1 (IDI1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IDI1 (Myc-DDK tagged) - Human isopentenyl-diphosphate delta isomerase 1 (IDI1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human isopentenyl-diphosphate delta isomerase 1 (IDI1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IDI1 (mGFP-tagged) - Human isopentenyl-diphosphate delta isomerase 1 (IDI1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IDI1 (GFP-tagged) - Human isopentenyl-diphosphate delta isomerase 1 (IDI1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Idi1 (Myc-DDK-tagged ORF) - Rat isopentenyl-diphosphate delta isomerase 1 (Idi1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Idi1 (Myc-DDK-tagged ORF) - Rat isopentenyl-diphosphate delta isomerase 1 (Idi1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Idi1 (Myc-DDK-tagged ORF) - Rat isopentenyl-diphosphate delta isomerase 1 (Idi1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Idi1 (mGFP-tagged ORF) - Rat isopentenyl-diphosphate delta isomerase 1 (Idi1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Idi1 (GFP-tagged ORF) - Rat isopentenyl-diphosphate delta isomerase 1 (Idi1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human isopentenyl-diphosphate delta isomerase 1 (IDI1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
IDI1 (untagged)-Human isopentenyl-diphosphate delta isomerase 1 (IDI1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human isopentenyl-diphosphate delta isomerase 1 (IDI1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
IDI1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Idi1 (untagged) - Mouse isopentenyl-diphosphate delta isomerase (Idi1), transcript variant 2, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Idi1 (untagged ORF) - Rat isopentenyl-diphosphate delta isomerase 1 (Idi1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-IDI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IDI1 antibody: synthetic peptide directed towards the middle region of human IDI1. Synthetic peptide located within the following region: PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA |
IPP isomerase 1 / IDI1 (1-228, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
IPP isomerase 1 / IDI1 (1-228, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
IDI1 CRISPRa kit - CRISPR gene activation of human isopentenyl-diphosphate delta isomerase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Idi1 CRISPRa kit - CRISPR gene activation of mouse isopentenyl-diphosphate delta isomerase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene IDI1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene IDI1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of isopentenyl-diphosphate delta isomerase 1 (IDI1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Idi1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against mus musculus gene Idi1
3`UTR clone of isopentenyl-diphosphate delta isomerase 1 (IDI1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
IDI1 (untagged)-Human isopentenyl-diphosphate delta isomerase 1 (IDI1)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
IDI1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Idi1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Idi1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
IDI1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 225-284 of human IDI1 (NP_004499.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IDI1