Germany
Japan
United Kingdom
China
IL4R (Myc-DDK-tagged)-Human interleukin 4 receptor (IL4R), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, IL4R (Myc-DDK tagged) - Human interleukin 4 receptor (IL4R), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, IL4R (mGFP-tagged) - Human interleukin 4 receptor (IL4R), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
IL4R (GFP-tagged) - Human interleukin 4 receptor (IL4R), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL4R (Myc-DDK tagged) - Homo sapiens interleukin 4 receptor (IL4R), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, IL4R (Myc-DDK tagged) - Human interleukin 4 receptor (IL4R), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, IL4R (mGFP-tagged) - Human interleukin 4 receptor (IL4R), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IL4R - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN414464 is the updated version of KN214464.
IL4R (Myc-DDK tagged) - Homo sapiens interleukin 4 receptor (IL4R), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL4R (myc-DDK-tagged) - Human interleukin 4 receptor (IL4R), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL4R (GFP-tagged) - Homo sapiens interleukin 4 receptor (IL4R), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL4R (GFP-tagged) - Homo sapiens interleukin 4 receptor (IL4R), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Il4ra (Myc-DDK-tagged ORF) - Rat interleukin 4 receptor, alpha (Il4ra), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Il4ra (Myc-DDK-tagged ORF) - Rat interleukin 4 receptor, alpha (Il4ra), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Il4ra (Myc-DDK-tagged ORF) - Rat interleukin 4 receptor, alpha (Il4ra), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Il4ra (mGFP-tagged ORF) - Rat interleukin 4 receptor, alpha (Il4ra), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Il4ra (GFP-tagged ORF) - Rat interleukin 4 receptor, alpha (Il4ra), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IL4R (untagged)-Human interleukin 4 receptor (IL4R), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC124089 is the updated version of SC119877.
Lenti ORF clone of Human interleukin 4 receptor (IL4R), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human interleukin 4 receptor (IL4R), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human interleukin 4 receptor (IL4R), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human interleukin 4 receptor (IL4R), transcript variant 1.
| Tag | Tag Free |
| Expression Host | HEK293 |
IL4R HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of interleukin 4 receptor (IL4R), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
IL4R rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 460-510 of Human IL-4Rα. |
Lenti ORF clone of Human interleukin 4 receptor (IL4R), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
IL4R (untagged)-Human interleukin 4 receptor (IL4R), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
qSTAR qPCR primer pairs against Homo sapiens gene IL4R
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
IL4R (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Purified recombinant protein of Human interleukin 4 receptor (IL4R), transcript variant 1, Met26-His232, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-IL4R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL4R antibody is: synthetic peptide directed towards the C-terminal region of Human IL4R. Synthetic peptide located within the following region: GLDREPPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVD |
IL4R - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Human CD124 ELISA Kit, 1 x 48-well (pre-coated)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 1 x 48-well (pre-coated) |
Human CD124 ELISA Kit, 1 x 96-well (pre-coated)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 1 x 96-well (pre-coated) |
Human CD124 ELISA Kit, 2 x 96-well (pre-coated)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 2 x 96-well (pre-coated) |
For quantitative detection of human IL4R in cell culture supernates, serum and plasma (heparin, EDTA, citrate).
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human IL4R |
| Format | 8x12 divisible strips |
| Reactivities | Human |
IL4R CRISPRa kit - CRISPR gene activation of human interleukin 4 receptor
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene IL4R
| Application | Plasmid of exact quantity for transcript copy number calculation |
IL4R (GFP-tagged) - Human interleukin 4 receptor (IL4R), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Il4ra (untagged ORF) - Rat interleukin 4 receptor, alpha (Il4ra), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of interleukin 4 receptor (IL4R) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of interleukin 4 receptor (IL4R) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
IL4R (untagged) - Homo sapiens interleukin 4 receptor (IL4R), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
IL4R (untagged) - Homo sapiens interleukin 4 receptor (IL4R), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
IL4R (untagged) - Human interleukin 4 receptor (IL4R), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Il4ra (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Active filters
Target Symbol
- IL4R