Products

cDNA Clones (37)
Antibodies (35)
RNAi (14)
Gene Expression (6)
Proteins (6)
Jump to Filters
View as table Download
c Maf (MAF) (NM_005360) Human Tagged ORF Clone
RC216495

USD 420.00

In Stock

MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Maf (NM_001025577) Mouse Tagged ORF Clone
MR227131

USD 420.00

In Stock

Maf (Myc-DDK-tagged) - Mouse avian musculoaponeurotic fibrosarcoma (v-maf) AS42 oncogene homolog (Maf)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone Lentiviral Particle
RC209247L1V

USD 820.00

6 Weeks

Lenti ORF particles, MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone Lentiviral Particle
RC209247L2V

USD 820.00

3 Weeks

Lenti ORF particles, MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone Lentiviral Particle
RC216495L1V

USD 820.00

3 Weeks

Lenti ORF particles, MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone Lentiviral Particle
RC216495L2V

USD 820.00

3 Weeks

Lenti ORF particles, MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Maf (NM_001025577) Mouse Tagged ORF Clone
MG227131

USD 460.00

In Stock

Maf (GFP-tagged) - Mouse avian musculoaponeurotic fibrosarcoma (v-maf) AS42 oncogene homolog (Maf), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone
RG216495

USD 460.00

In Stock

MAF (GFP-tagged) - Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone
RC209247

USD 420.00

In Stock

MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone
RC216495L3

USD 620.00

In Stock

Lenti-ORF clone of MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone
RC216495L4

USD 620.00

2 Weeks

Lenti-ORF clone of MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Maf Mouse Gene Knockout Kit (CRISPR)
KN509644

USD 1,290.00

2 Weeks

Maf - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN509644 is the updated version of KN309644.
Maf (NM_001025577) Mouse Tagged ORF Clone
MR227131L3

USD 620.00

3 Weeks

Lenti ORF clone of Maf (Myc-DDK-tagged) - Mouse avian musculoaponeurotic fibrosarcoma (v-maf) AS42 oncogene homolog (Maf)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Maf (NM_001025577) Mouse Tagged ORF Clone Lentiviral Particle
MR227131L3V

USD 820.00

6 Weeks

Lenti ORF particles, Maf (Myc-DDK-tagged) - Mouse avian musculoaponeurotic fibrosarcoma (v-maf) AS42 oncogene homolog (Maf), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Maf (NM_001025577) Mouse Tagged ORF Clone
MR227131L4

USD 620.00

3 Weeks

Lenti ORF clone of Maf (mGFP-tagged) - Mouse avian musculoaponeurotic fibrosarcoma (v-maf) AS42 oncogene homolog (Maf)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Maf (NM_001025577) Mouse Tagged ORF Clone Lentiviral Particle
MR227131L4V

USD 820.00

6 Weeks

Lenti ORF particles, Maf (GFP-tagged) - Mouse avian musculoaponeurotic fibrosarcoma (v-maf) AS42 oncogene homolog (Maf), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone
RC209247L3

USD 620.00

3 Weeks

Lenti-ORF clone of MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone Lentiviral Particle
RC209247L3V

USD 820.00

11 Weeks

Lenti ORF particles, MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone
RC209247L4

USD 620.00

3 Weeks

Lenti-ORF clone of MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone Lentiviral Particle
RC209247L4V

USD 820.00

5 Weeks

Lenti ORF particles, MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone Lentiviral Particle
RC216495L3V

USD 820.00

3 Weeks

Lenti ORF particles, MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone Lentiviral Particle
RC216495L4V

USD 820.00

11 Weeks

Lenti ORF particles, MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_005360) Human Mutant ORF Clone
RC402776

USD 680.00

2 Weeks

MAF Mutant (R288P), Myc-DDK-tagged ORF clone of Homo sapiens v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1 as transfection-ready DNA

Mutation R288P
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_005360) Human Mutant ORF Clone
RC402777

USD 680.00

2 Weeks

MAF Mutant (K297R), Myc-DDK-tagged ORF clone of Homo sapiens v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1 as transfection-ready DNA

Mutation K297R
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_005360) Human Mutant ORF Clone
RC402778

USD 680.00

2 Weeks

MAF Mutant (R299S), Myc-DDK-tagged ORF clone of Homo sapiens v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1 as transfection-ready DNA

Mutation R299S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone
RG209247

USD 460.00

3 Weeks

MAF (GFP-tagged) - Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Maf (NM_019318) Rat Tagged ORF Clone
RR209464

USD 420.00

4 Weeks

Maf (Myc-DDK-tagged ORF) - Rat v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (Maf), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Maf (NM_019318) Rat Tagged ORF Clone
RR209464L3

USD 640.00

10 Weeks

Lenti ORF clone of Maf (Myc-DDK-tagged ORF) - Rat v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (Maf), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Maf (NM_019318) Rat Tagged ORF Clone Lentiviral Particle
RR209464L3V

USD 850.00

14 Weeks

Lenti ORF particles, Maf (Myc-DDK-tagged ORF) - Rat v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (Maf), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Maf (NM_019318) Rat Tagged ORF Clone
RR209464L4

USD 700.00

10 Weeks

Lenti ORF clone of Maf (mGFP-tagged ORF) - Rat v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (Maf), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Maf (NM_019318) Rat Tagged ORF Clone Lentiviral Particle
RR209464L4V

USD 960.00

14 Weeks

Lenti ORF particles, Maf (GFP-tagged ORF) - Rat v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (Maf), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_005360) Human Untagged Clone
SC116772

USD 690.00

In Stock

MAF (untagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Maf (NM_001025577) Mouse Untagged Clone
MC208926

USD 420.00

In Stock

Maf (untagged) - Mouse avian musculoaponeurotic fibrosarcoma (v-maf) AS42 oncogene homolog (Maf), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
c Maf (MAF) Human qPCR Primer Pair (NM_005360)
HP225766

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene MAF

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Maf Mouse shRNA Plasmid (Locus ID 17132)
TG501289

USD 715.00

In Stock

Maf - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone
RC209247L2

USD 620.00

In Stock

Lenti-ORF clone of MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MAF Human siRNA Oligo Duplex (Locus ID 4094)
SR302773

USD 430.00

In Stock

MAF (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

c Maf (MAF) Rabbit Polyclonal Antibody
TA347630

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Maf Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Maf Antibody: A synthesized peptide derived from human Maf
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone
RC209247L1

USD 620.00

3 Weeks

Lenti-ORF clone of MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
c Maf (MAF) Rabbit Polyclonal Antibody
TA337003

USD 424.00

2 Weeks

Rabbit Polyclonal c-Maf Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 75-110 of human c-maf was used as the immunogen, GenBank no. NP_001026974.1|.
MAF Human shRNA Plasmid Kit (Locus ID 4094)
TL320410

USD 815.00

In Stock

MAF - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
Maf Mouse shRNA Plasmid (Locus ID 17132)
TL501289

USD 815.00

In Stock

Maf - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Maf Mouse qPCR Primer Pair (NM_001025577)
MP201187

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Maf

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
c Maf (MAF) Rabbit Polyclonal Antibody
TA314171

USD 345.00

4 Weeks

Rabbit polyclonal anti-Maf antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Maf.
c Maf (MAF) Rabbit Polyclonal Antibody
TA343531

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAF Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAF antibody is: synthetic peptide directed towards the C-terminal region of Human MAF. Synthetic peptide located within the following region: DAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWK
c Maf (MAF) Rabbit Polyclonal Antibody
AP20377PU-N

USD 370.00

2 Weeks

c Maf (MAF) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
c Maf (MAF) Rabbit Polyclonal Antibody
TA330032

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAF antibody: synthetic peptide directed towards the middle region of human MAF. Synthetic peptide located within the following region: LQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFI
c Maf (MAF) Rabbit Polyclonal Antibody
TA343530

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAF antibody: synthetic peptide directed towards the N terminal of human MAF. Synthetic peptide located within the following region: MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLI
Maf Mouse shRNA Plasmid (Locus ID 17132)
TF501289

USD 715.00

2 Weeks

Maf - Mouse, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI2B12]
CF812376

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MAF mouse monoclonal antibody,clone OTI2B12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated