Products

Antibodies (42)
cDNA Clones (39)
Proteins (18)
RNAi (12)
Gene Expression (9)
Jump to Filters
View as table Download
NIPP1 (PPP1R8) (NM_138558) Human Tagged ORF Clone
RC210575

USD 98.00

USD 390.00

In Stock

PPP1R8 (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NIPP1 (PPP1R8) (NM_014110) Human Tagged ORF Clone
RC218843

USD 420.00

In Stock

PPP1R8 (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Ppp1r8 (NM_146154) Mouse Tagged ORF Clone
MR205326

USD 300.00

In Stock

Ppp1r8 (Myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ppp1r8 (NM_146154) Mouse Tagged ORF Clone
MG205326

USD 330.00

In Stock

Ppp1r8 (GFP-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NIPP1 (PPP1R8) (NM_138558) Human Tagged ORF Clone
RG210575

USD 460.00

In Stock

PPP1R8 (GFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NIPP1 (PPP1R8) (NM_014110) Human Tagged ORF Clone
RG218843

USD 460.00

In Stock

PPP1R8 (GFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ppp1r8 Mouse Gene Knockout Kit (CRISPR)
KN513762

USD 1,290.00

2 Weeks

Ppp1r8 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513762 is the updated version of KN313762.
Ppp1r8 (NM_146154) Mouse Tagged ORF Clone
MR205326L3

USD 500.00

3 Weeks

Lenti ORF clone of Ppp1r8 (Myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppp1r8 (NM_146154) Mouse Tagged ORF Clone Lentiviral Particle
MR205326L3V

USD 700.00

6 Weeks

Lenti ORF particles, Ppp1r8 (Myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppp1r8 (NM_146154) Mouse Tagged ORF Clone
MR205326L4

USD 500.00

3 Weeks

Lenti ORF clone of Ppp1r8 (mGFP-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppp1r8 (NM_146154) Mouse Tagged ORF Clone Lentiviral Particle
MR205326L4V

USD 700.00

6 Weeks

Lenti ORF particles, Ppp1r8 (GFP-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppp1r8 (NM_001290725) Mouse Tagged ORF Clone
MR229423

USD 370.00

2 Weeks

Ppp1r8 (myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NIPP1 (PPP1R8) (NM_138558) Human Tagged ORF Clone
RC210575L3

USD 620.00

3 Weeks

Lenti-ORF clone of PPP1R8 (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) (NM_138558) Human Tagged ORF Clone Lentiviral Particle
RC210575L3V

USD 820.00

6 Weeks

Lenti ORF particles, PPP1R8 (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) (NM_138558) Human Tagged ORF Clone
RC210575L4

USD 620.00

3 Weeks

Lenti-ORF clone of PPP1R8 (mGFP-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) (NM_138558) Human Tagged ORF Clone Lentiviral Particle
RC210575L4V

USD 820.00

6 Weeks

Lenti ORF particles, PPP1R8 (mGFP-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) (NM_002713) Human Tagged ORF Clone
RC216856

USD 420.00

2 Weeks

PPP1R8 (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NIPP1 (PPP1R8) (NM_002713) Human Tagged ORF Clone
RC216856L3

USD 620.00

8 Weeks

Lenti-ORF clone of PPP1R8 (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) (NM_002713) Human Tagged ORF Clone Lentiviral Particle
RC216856L3V

USD 820.00

11 Weeks

Lenti ORF particles, PPP1R8 (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) (NM_002713) Human Tagged ORF Clone
RC216856L4

USD 620.00

8 Weeks

Lenti-ORF clone of PPP1R8 (mGFP-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) (NM_002713) Human Tagged ORF Clone Lentiviral Particle
RC216856L4V

USD 820.00

11 Weeks

Lenti ORF particles, PPP1R8 (mGFP-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) (NM_014110) Human Tagged ORF Clone
RC218843L3

USD 620.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) (NM_014110) Human Tagged ORF Clone Lentiviral Particle
RC218843L3V

USD 820.00

6 Weeks

Lenti ORF particles, PPP1R8 (Myc-DDK tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) (NM_014110) Human Tagged ORF Clone
RC218843L4

USD 620.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) (NM_014110) Human Tagged ORF Clone Lentiviral Particle
RC218843L4V

USD 820.00

6 Weeks

Lenti ORF particles, PPP1R8 (mGFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) (NM_002713) Human Tagged ORF Clone
RG216856

USD 460.00

3 Weeks

PPP1R8 (GFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ppp1r8 (NM_001107911) Rat Tagged ORF Clone
RR213284

USD 420.00

4 Weeks

Ppp1r8 (Myc-DDK-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ppp1r8 (NM_001107911) Rat Tagged ORF Clone
RR213284L3

USD 640.00

8 Weeks

Lenti ORF clone of Ppp1r8 (Myc-DDK-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppp1r8 (NM_001107911) Rat Tagged ORF Clone Lentiviral Particle
RR213284L3V

USD 850.00

12 Weeks

Lenti ORF particles, Ppp1r8 (Myc-DDK-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppp1r8 (NM_001107911) Rat Tagged ORF Clone
RR213284L4

USD 700.00

8 Weeks

Lenti ORF clone of Ppp1r8 (mGFP-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppp1r8 (NM_001107911) Rat Tagged ORF Clone Lentiviral Particle
RR213284L4V

USD 960.00

12 Weeks

Lenti ORF particles, Ppp1r8 (GFP-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NIPP1 (PPP1R8) Rabbit Polyclonal Antibody
TA343798

USD 410.00

5 Days

Rabbit Polyclonal Anti-PPP1R8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the N terminal of human PPP1R8. Synthetic peptide located within the following region: THGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD
NIPP1 (PPP1R8) Rabbit Polyclonal Antibody
TA345806

USD 410.00

5 Days

Rabbit Polyclonal Anti-PPP1R8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the middle region of human PPP1R8. Synthetic peptide located within the following region: PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK
NIPP1 (PPP1R8) Rabbit Polyclonal Antibody
TA343799

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPP1R8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the N terminal of human PPP1R8. Synthetic peptide located within the following region: DKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKHLKRVF
NIPP1 (PPP1R8) Rabbit Polyclonal Antibody
TA345805

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPP1R8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the middle region of human PPP1R8. Synthetic peptide located within the following region: VDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY
NIPP1 (PPP1R8) (NM_138558) Human Over-expression Lysate
LY408577

USD 396.00

In Stock

Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NIPP1 (PPP1R8) (NM_014110) Human Untagged Clone
SC115156

USD 760.00

In Stock

PPP1R8 (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
NIPP1 (PPP1R8) Rabbit Polyclonal Antibody
TA314374

USD 345.00

In Stock

Rabbit polyclonal anti-PPP1R8 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP1R8.
PPP1R8 Human shRNA Plasmid Kit (Locus ID 5511)
TR310230

USD 715.00

In Stock

PPP1R8 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
NIPP1 (PPP1R8) (NM_138558) Human Over-expression Lysate
LC408577

USD 121.00

In Stock

PPP1R8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Ppp1r8 (NM_146154) Mouse Untagged Clone
MC201734

USD 210.00

In Stock

Ppp1r8 (untagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 8 (Ppp1r8), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
NIPP1 (PPP1R8) (NM_138558) Human Untagged Clone
SC109604

USD 310.00

In Stock

PPP1R8 (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
NIPP1 (PPP1R8) (NM_002713) Human Untagged Clone
SC124701

USD 420.00

In Stock

PPP1R8 (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
NIPP1 (PPP1R8) (NM_014110) Human Over-expression Lysate
LY415484

USD 396.00

5 Days

Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NIPP1 (PPP1R8) Goat Polyclonal Antibody
TA302884

USD 375.00

5 Days

Goat Polyclonal Antibody against PPP1R8

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EAWPGKKPTPSLLI, from the C Terminus of the protein sequence according to NP_002704; NP_054829; NP_612568.
NIPP-1 (1-351, His-tag) Human Protein
AR50527PU-N

USD 845.00

2 Weeks

NIPP-1 (1-351, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
NIPP-1 (1-351, His-tag) Human Protein
AR50527PU-S

USD 330.00

2 Weeks

NIPP-1 (1-351, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
NIPP1 (PPP1R8) Mouse Monoclonal Antibody [Clone ID: OTI1E2]
CF804570

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PPP1R8 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NIPP1 (PPP1R8) Mouse Monoclonal Antibody [Clone ID: OTI1E9]
CF804571

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) Purified PPP1R8 mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated