RAB30 (Myc-DDK-tagged)-Human RAB30, member RAS oncogene family (RAB30)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAB30 (Myc-DDK-tagged)-Human RAB30, member RAS oncogene family (RAB30)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human RAB30, member RAS oncogene family (RAB30)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Rab30 (Myc-DDK-tagged) - Mouse RAB30, member RAS oncogene family (Rab30)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAB30 (myc-DDK-tagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAB30 (myc-DDK-tagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAB30 (myc-DDK-tagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAB30 (GFP-tagged) - Human RAB30, member RAS oncogene family (RAB30)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RAB30 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Rab30 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Rab30 (GFP-tagged) - Mouse RAB30, member RAS oncogene family (Rab30)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Rab30 (Myc-DDK-tagged) - Mouse RAB30, member RAS oncogene family (Rab30)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Rab30 (Myc-DDK-tagged) - Mouse RAB30, member RAS oncogene family (Rab30), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Rab30 (mGFP-tagged) - Mouse RAB30, member RAS oncogene family (Rab30)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Rab30 (GFP-tagged) - Mouse RAB30, member RAS oncogene family (Rab30), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human RAB30, member RAS oncogene family (RAB30), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RAB30 (Myc-DDK tagged) - Human RAB30, member RAS oncogene family (RAB30), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human RAB30, member RAS oncogene family (RAB30), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RAB30 (mGFP-tagged) - Human RAB30, member RAS oncogene family (RAB30), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rab30 (Myc-DDK-tagged ORF) - Rat RAB30, member RAS oncogene family (Rab30), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Rab30 (Myc-DDK-tagged ORF) - Rat RAB30, member RAS oncogene family (Rab30), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Rab30 (Myc-DDK-tagged ORF) - Rat RAB30, member RAS oncogene family (Rab30), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Rab30 (mGFP-tagged ORF) - Rat RAB30, member RAS oncogene family (Rab30), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Rab30 (GFP-tagged ORF) - Rat RAB30, member RAS oncogene family (Rab30), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RAB30 (untagged)-Human RAB30, member RAS oncogene family (RAB30)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
RAB30 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rab30 (untagged) - Mouse RAB30, member RAS oncogene family (Rab30), (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of RAB30, member RAS oncogene family (RAB30)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Rab30
Rabbit Polyclonal Anti-RAB30 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RAB30 antibody is: synthetic peptide directed towards the C-terminal region of Human RAB30. Synthetic peptide located within the following region: EIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKE |
Rabbit Polyclonal Anti-RAB30 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RAB30 antibody is: synthetic peptide directed towards the C-terminal region of Human RAB30. Synthetic peptide located within the following region: ERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQN |
Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI3B7 (formerly 3B7)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI3E7 (formerly 3E7)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI3B1 (formerly 3B1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAB30 CRISPRa kit - CRISPR gene activation of human RAB30, member RAS oncogene family
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene RAB30
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene RAB30
qPCR primer pairs and template standards against Mus musculus gene Rab30
Application | Plasmid of exact quantity for transcript copy number calculation |
RAB30 MS Standard C13 and N15-labeled recombinant protein (NP_055303)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
RAB30 (GFP-tagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RAB30 (GFP-tagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RAB30 (GFP-tagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rab30 (untagged ORF) - Rat RAB30, member RAS oncogene family (Rab30), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of RAB30 member RAS oncogene family (RAB30) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
RAB30 (untagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |