Products

Antibodies (47)
cDNA Clones (30)
Proteins (17)
RNAi (12)
Gene Expression (7)
Jump to Filters
View as table Download
RAB30 (NM_014488) Human Tagged ORF Clone
RC204318

USD 98.00

USD 390.00

In Stock

RAB30 (Myc-DDK-tagged)-Human RAB30, member RAS oncogene family (RAB30)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Rab30 (NM_029494) Mouse Tagged ORF Clone
MR202099

USD 68.00

USD 149.00

In Stock

Rab30 (Myc-DDK-tagged) - Mouse RAB30, member RAS oncogene family (Rab30)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAB30 (NM_001286059) Human Tagged ORF Clone
RC236531

USD 420.00

In Stock

RAB30 (myc-DDK-tagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAB30 (NM_001286060) Human Tagged ORF Clone
RC236532

USD 420.00

In Stock

RAB30 (myc-DDK-tagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAB30 (NM_001286061) Human Tagged ORF Clone
RC236533

USD 420.00

In Stock

RAB30 (myc-DDK-tagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAB30 (NM_014488) Human Tagged ORF Clone
RG204318

USD 460.00

In Stock

RAB30 (GFP-tagged) - Human RAB30, member RAS oncogene family (RAB30)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAB30 Human Gene Knockout Kit (CRISPR)
KN404318

USD 1,290.00

2 Weeks

RAB30 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN404318 is the updated version of KN204318.
Rab30 Mouse Gene Knockout Kit (CRISPR)
KN514351

USD 1,290.00

2 Weeks

Rab30 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN514351 is the updated version of KN314351.
Rab30 (NM_029494) Mouse Tagged ORF Clone
MG202099

USD 300.00

3 Weeks

Rab30 (GFP-tagged) - Mouse RAB30, member RAS oncogene family (Rab30)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rab30 (NM_029494) Mouse Tagged ORF Clone
MR202099L3

USD 500.00

3 Weeks

Lenti ORF clone of Rab30 (Myc-DDK-tagged) - Mouse RAB30, member RAS oncogene family (Rab30)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rab30 (NM_029494) Mouse Tagged ORF Clone Lentiviral Particle
MR202099L3V

USD 700.00

6 Weeks

Lenti ORF particles, Rab30 (Myc-DDK-tagged) - Mouse RAB30, member RAS oncogene family (Rab30), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rab30 (NM_029494) Mouse Tagged ORF Clone
MR202099L4

USD 500.00

3 Weeks

Lenti ORF clone of Rab30 (mGFP-tagged) - Mouse RAB30, member RAS oncogene family (Rab30)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rab30 (NM_029494) Mouse Tagged ORF Clone Lentiviral Particle
MR202099L4V

USD 700.00

6 Weeks

Lenti ORF particles, Rab30 (GFP-tagged) - Mouse RAB30, member RAS oncogene family (Rab30), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RAB30 (NM_014488) Human Tagged ORF Clone
RC204318L3

USD 620.00

3 Weeks

Lenti ORF clone of Human RAB30, member RAS oncogene family (RAB30), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RAB30 (NM_014488) Human Tagged ORF Clone Lentiviral Particle
RC204318L3V

USD 820.00

6 Weeks

Lenti ORF particles, RAB30 (Myc-DDK tagged) - Human RAB30, member RAS oncogene family (RAB30), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RAB30 (NM_014488) Human Tagged ORF Clone
RC204318L4

USD 620.00

3 Weeks

Lenti ORF clone of Human RAB30, member RAS oncogene family (RAB30), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RAB30 (NM_014488) Human Tagged ORF Clone Lentiviral Particle
RC204318L4V

USD 820.00

6 Weeks

Lenti ORF particles, RAB30 (mGFP-tagged) - Human RAB30, member RAS oncogene family (RAB30), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rab30 (NM_001015012) Rat Tagged ORF Clone
RR205283

USD 420.00

3 Weeks

Rab30 (Myc-DDK-tagged ORF) - Rat RAB30, member RAS oncogene family (Rab30), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rab30 (NM_001015012) Rat Tagged ORF Clone
RR205283L3

USD 640.00

7 Weeks

Lenti ORF clone of Rab30 (Myc-DDK-tagged ORF) - Rat RAB30, member RAS oncogene family (Rab30), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rab30 (NM_001015012) Rat Tagged ORF Clone Lentiviral Particle
RR205283L3V

USD 850.00

11 Weeks

Lenti ORF particles, Rab30 (Myc-DDK-tagged ORF) - Rat RAB30, member RAS oncogene family (Rab30), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rab30 (NM_001015012) Rat Tagged ORF Clone
RR205283L4

USD 700.00

7 Weeks

Lenti ORF clone of Rab30 (mGFP-tagged ORF) - Rat RAB30, member RAS oncogene family (Rab30), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rab30 (NM_001015012) Rat Tagged ORF Clone Lentiviral Particle
RR205283L4V

USD 960.00

11 Weeks

Lenti ORF particles, Rab30 (GFP-tagged ORF) - Rat RAB30, member RAS oncogene family (Rab30), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RAB30 (NM_014488) Human Untagged Clone
SC114984

USD 310.00

In Stock

RAB30 (untagged)-Human RAB30, member RAS oncogene family (RAB30)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RAB30 (NM_014488) Human Over-expression Lysate
LC415246

USD 121.00

In Stock

RAB30 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Rab30 (NM_029494) Mouse Untagged Clone
MC203956

USD 210.00

In Stock

Rab30 (untagged) - Mouse RAB30, member RAS oncogene family (Rab30), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
RAB30 (NM_014488) Human Over-expression Lysate
LY415246

USD 396.00

5 Days

Transient overexpression lysate of RAB30, member RAS oncogene family (RAB30)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Rab30 Mouse qPCR Primer Pair (NM_029494)
MP212326

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Rab30

RAB30 Rabbit Polyclonal Antibody
TA331290

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAB30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAB30 antibody is: synthetic peptide directed towards the C-terminal region of Human RAB30. Synthetic peptide located within the following region: EIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKE
RAB30 Rabbit Polyclonal Antibody
TA331291

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAB30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAB30 antibody is: synthetic peptide directed towards the C-terminal region of Human RAB30. Synthetic peptide located within the following region: ERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQN
RAB30 Mouse Monoclonal Antibody [Clone ID: OTI3B7]
CF505316

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI3B7 (formerly 3B7)

Applications IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
RAB30 Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF505317

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
RAB30 Mouse Monoclonal Antibody [Clone ID: OTI3C6]
CF505318

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RAB30 Mouse Monoclonal Antibody [Clone ID: OTI3F4]
CF505341

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
RAB30 Mouse Monoclonal Antibody [Clone ID: OTI4B10]
CF505342

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RAB30 Mouse Monoclonal Antibody [Clone ID: OTI4B9]
CF505343

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RAB30 Mouse Monoclonal Antibody [Clone ID: OTI3E7]
CF505344

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI3E7 (formerly 3E7)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
RAB30 Mouse Monoclonal Antibody [Clone ID: OTI1D3]
CF505346

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RAB30 Mouse Monoclonal Antibody [Clone ID: OTI3B1]
CF505347

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAB30 mouse monoclonal antibody, clone OTI3B1 (formerly 3B1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human RAB30 activation kit by CRISPRa
GA109116

USD 1,290.00

2 Weeks

RAB30 CRISPRa kit - CRISPR gene activation of human RAB30, member RAS oncogene family

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
RAB30 Human qPCR Template Standard (NM_014488)
HK206078

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene RAB30

Application Plasmid of exact quantity for transcript copy number calculation
RAB30 Human qPCR Primer Pair (NM_014488)
HP210928

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene RAB30

Rab30 Mouse qPCR Template Standard (NM_029494)
MK203318

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Rab30

Application Plasmid of exact quantity for transcript copy number calculation
RAB30 (NM_014488) Human Mass Spec Standard
PH304318

USD 2,055.00

3 Weeks

RAB30 MS Standard C13 and N15-labeled recombinant protein (NP_055303)

Tag C-Myc/DDK
Expression Host HEK293
RAB30 (NM_001286059) Human Tagged ORF Clone
RG236531

USD 460.00

2 Weeks

RAB30 (GFP-tagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAB30 (NM_001286060) Human Tagged ORF Clone
RG236532

USD 460.00

2 Weeks

RAB30 (GFP-tagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAB30 (NM_001286061) Human Tagged ORF Clone
RG236533

USD 460.00

2 Weeks

RAB30 (GFP-tagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rab30 (NM_001015012) Rat Untagged Clone
RN205283

USD 420.00

3 Weeks

Rab30 (untagged ORF) - Rat RAB30, member RAS oncogene family (Rab30), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
RAB30 (NM_014488) Human 3' UTR Clone
SC209501

USD 560.00

4 Weeks

3`UTR clone of RAB30 member RAS oncogene family (RAB30) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
RAB30 (NM_001286059) Human Untagged Clone
SC334425

USD 341.00

2 Weeks

RAB30 (untagged) - Human RAB30, member RAS oncogene family (RAB30), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free