2A (NC_012798) Virus Tagged ORF Clone

CAT#: VC100648

  • TrueORF®

Myc-DDK-tagged ORF clone of viral ORF for 2A [Human cosavirus E], codon optimized for human cell expression, YP_002956081


  View other clones from "Virus" (9)

Reconstitution Protocol

USD 400.00

3 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Type Virus Tagged ORF Clone
Tag Myc-DDK
Symbol 2A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC100648 represents NCBI reference of YP_002956081 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTAATCCATCATCTCGGGTAAGGATGGCGGCTTCTGATGGATTGGCTCCAAGAAAATACCTCTCAT
ACCGAAAGATCCAGCTTAGCGGGGACGTGGAAACTAATCCGGGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC100648 representing YP_002956081
Red=Cloning sites Green=Tags

MPNPSSRVRMAASDGLAPRKYLSYRKIQLSGDVETNPG

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NC_012798
ORF Size 114 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Reference Data
RefSeq NC_012798.1, YP_002956081
RefSeq ORF 114
MW 4.2 kDa

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.