nonstructural protein NS4A (NC_012532) Virus Tagged ORF Clone

CAT#: VC102535

Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4A [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227203.1

Specifications

Product Data

• Type: Virus Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: nonstructural protein NS4A
• Synonyms: ZIKV_gp1, ZIKV
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >The Viral ORF clone VC102535 represents NCBI reference of YP_009227203 with codon optimized for human cell expression
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGAGCAGCACTCGGCGTGATGGAAGCACTCGGAACCCTCCCTGGACACATGACTGAGAGATTTCAGG
  AAGCTATAGACAACCTTGCCGTGTTGATGAGAGCTGAGACAGGATCTCGACCTTACAAAGCCGCCGCTGC
  ACAGCTGCCCGAAACACTCGAAACGATCATGTTGCTTGGACTCCTCGGAACAGTCTCACTCGGGATTTTT
  TTCGTTTTGATGCGCAACAAAGGAATTGGAAAGATGGGATTCGGAATGGTCACTCTCGGAGCTTCTGCCT
  GGCTGATGTGGCTTAGCGAAATTGAGCCCGCTAGAATTGCCTGTGTACTGATTGTCGTGTTTCTCCTCCT
  CGTCGTCCTCATCCCCGAACCAGAAAAACAACGG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >VC102535 representing YP_009227203
  Red=Cloning sites Green=Tags
  
  MGAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIF
  FVLMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene
• ACCN: NC_012532
• ORF Size: 384 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NC_012532.1, YP_009227203
• RefSeq ORF: 384 bp
• MW: 13.8 kDa