nonstructural protein NS4A (NC_012532) Virus Tagged ORF Clone

CAT#: VC102535

  • TrueORF®

Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4A [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227203.1


  View other clones from "Virus" (13)

Reconstitution Protocol

USD 400.00

In Stock*

Size
    • 10 ug

Product Images

Specifications

Product Data
Type Virus Tagged ORF Clone
Tag Myc-DDK
Symbol nonstructural protein NS4A
Synonyms ZIKV_gp1, ZIKV
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC102535 represents NCBI reference of YP_009227203 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAGCAGCACTCGGCGTGATGGAAGCACTCGGAACCCTCCCTGGACACATGACTGAGAGATTTCAGG
AAGCTATAGACAACCTTGCCGTGTTGATGAGAGCTGAGACAGGATCTCGACCTTACAAAGCCGCCGCTGC
ACAGCTGCCCGAAACACTCGAAACGATCATGTTGCTTGGACTCCTCGGAACAGTCTCACTCGGGATTTTT
TTCGTTTTGATGCGCAACAAAGGAATTGGAAAGATGGGATTCGGAATGGTCACTCTCGGAGCTTCTGCCT
GGCTGATGTGGCTTAGCGAAATTGAGCCCGCTAGAATTGCCTGTGTACTGATTGTCGTGTTTCTCCTCCT
CGTCGTCCTCATCCCCGAACCAGAAAAACAACGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC102535 representing YP_009227203
Red=Cloning sites Green=Tags

MGAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIF
FVLMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NC_012532
ORF Size 384 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NC_012532.1, YP_009227203
RefSeq ORF 384 bp
MW 13.8 kDa

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.