Rabbit Polyclonal Anti-STK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit Polyclonal Anti-STK3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the N terminal of human STK3. Synthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG |
Rabbit Polyclonal Anti-ARRB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
Rabbit Polyclonal Anti-NFATC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the C terminal of human NFATC2. Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE |
Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RELB antibody: synthetic peptide directed towards the middle region of human RELB. Synthetic peptide located within the following region: DLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPGPGDGGTASL |
Rabbit Polyclonal Anti-EVI1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the middle region of human EVI1. Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT |
Rabbit Polyclonal Anti-EVI1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the middle region of human EVI1. Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT |
Rabbit Polyclonal Anti-EVI1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the N terminal of human EVI1. Synthetic peptide located within the following region: VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-PPM1B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPM1B antibody: synthetic peptide directed towards the N terminal of human PPM1B. Synthetic peptide located within the following region: EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN |
Rabbit Polyclonal Anti-PPM1A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPM1A antibody: synthetic peptide directed towards the middle region of human PPM1A. Synthetic peptide located within the following region: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK |
Rabbit Polyclonal Anti-NLK Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NLK antibody: synthetic peptide directed towards the middle region of human NLK. Synthetic peptide located within the following region: RLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI |
Rabbit Polyclonal Anti-NTF5 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NTF5 antibody: synthetic peptide directed towards the N terminal of human NTF5. Synthetic peptide located within the following region: LAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRESAGAPANRSRRGVSE |
Rabbit Polyclonal Anti-MAX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAX antibody: synthetic peptide directed towards the n terminal of human MAX. Synthetic peptide located within the following region: MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKAS |
Rabbit Polyclonal Anti-PLA2G5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the N terminal of human PLA2G5. Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW |
Rabbit Polyclonal Anti-MAP4K2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP4K2 antibody: synthetic peptide directed towards the N terminal of human MAP4K2. Synthetic peptide located within the following region: TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR |
Rabbit Polyclonal Anti-MAP4K2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP4K2 antibody: synthetic peptide directed towards the N terminal of human MAP4K2. Synthetic peptide located within the following region: HLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAE |
Rabbit Polyclonal Anti-MAP3K1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH |
Germany
Japan
United Kingdom
China
