Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HNRNPU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the C terminal of human HNRNPU. Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF

Rabbit Polyclonal Anti-RBM8A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM8A antibody: synthetic peptide directed towards the N terminal of human RBM8A. Synthetic peptide located within the following region: LHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDS

Rabbit Polyclonal Anti-SFRS10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the N terminal of human SFRS10. Synthetic peptide located within the following region: MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKS

Rabbit Polyclonal Anti-SFRS10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the middle region of human SFRS10. Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD

Rabbit Polyclonal Anti-SNRPD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPD1 antibody: synthetic peptide directed towards the N terminal of human SNRPD1. Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL

Rabbit Polyclonal Anti-SNRP70 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the N terminal of human SNRP70. Synthetic peptide located within the following region: YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK

Rabbit Polyclonal Anti-SNRP70 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the C terminal of human SNRP70. Synthetic peptide located within the following region: RERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDR

Rabbit Polyclonal Anti-SF3A1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3A1 antibody: synthetic peptide directed towards the N terminal of human SF3A1. Synthetic peptide located within the following region: QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT

Rabbit Polyclonal Anti-SF3A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3A1 antibody: synthetic peptide directed towards the N terminal of human SF3A1. Synthetic peptide located within the following region: RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ

Rabbit anti-PRPF31 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRPF31

Rabbit Polyclonal Anti-SNRP70 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the N terminal of human SNRP70. Synthetic peptide located within the following region: PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS

Rabbit Polyclonal Anti-PRPF8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPF8 antibody: synthetic peptide directed towards the N terminal of human PRPF8. Synthetic peptide located within the following region: SHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPR

Rabbit Polyclonal Anti-PRPF6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPF6 antibody: synthetic peptide directed towards the C terminal of human PRPF6. Synthetic peptide located within the following region: FWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR

Rabbit Polyclonal Anti-PRPF6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPF6 antibody: synthetic peptide directed towards the N terminal of human PRPF6. Synthetic peptide located within the following region: PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Rabbit Polyclonal Anti-SNRPA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPA1 antibody: synthetic peptide directed towards the N terminal of human SNRPA1. Synthetic peptide located within the following region: VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSD

Rabbit Polyclonal Anti-SFRS9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS9 antibody: synthetic peptide directed towards the middle region of human SFRS9. Synthetic peptide located within the following region: VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER

Rabbit Polyclonal Anti-HNRNPU Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the N terminal of human HNRNPU. Synthetic peptide located within the following region: NGAAGAADSGPMEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHG

Rabbit Polyclonal Anti-HNRPM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPM antibody: synthetic peptide directed towards the N terminal of human HNRPM. Synthetic peptide located within the following region: ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE

Rabbit Polyclonal Anti-hnRNP M Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-hnRNP M Antibody: A synthesized peptide derived from human hnRNP M

Rabbit Polyclonal Anti-hnRNP M Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-hnRNP M Antibody: A synthesized peptide derived from human hnRNP M

SNRPD3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 97~126 amino acids from the C-terminal region of Human snRNP-D3 / Sm-D3

Rabbit Polyclonal SkiP Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SkiP antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human SkiP .

Rabbit polyclonal anti-NCBP2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NCBP2.

Rabbit Polyclonal Anti-PRPF19 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK

Rabbit Polyclonal Anti-SKIIP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SKIIP antibody: synthetic peptide directed towards the N terminal of human SKIIP. Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE

SNRPD3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 8-38 amino acids from the N-terminal region of human SNRPD3

TRA2B (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 207-237 amino acids from the Central region of human TRA2B

Rabbit Polyclonal Anti-PRPF19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the N terminal of human PRPF19. Synthetic peptide located within the following region: VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP

Rabbit Polyclonal Anti-XAB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XAB2 antibody: synthetic peptide directed towards the N terminal of human XAB2. Synthetic peptide located within the following region: VKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKH

Rabbit Polyclonal Anti-XAB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XAB2 antibody: synthetic peptide directed towards the C terminal of human XAB2. Synthetic peptide located within the following region: KILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQS

Rabbit Polyclonal Anti-EIF4A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4A3 antibody: synthetic peptide directed towards the N terminal of human EIF4A3. Synthetic peptide located within the following region: RGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL

Rabbit Polyclonal Anti-DDX48 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX48 antibody: synthetic peptide directed towards the middle region of human DDX48. Synthetic peptide located within the following region: QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV

Rabbit Polyclonal Anti-HNRNPM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNRNPM