ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
VDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human VDAC1 |
Rabbit polyclonal anti-VDAC1/Porin antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 211 of VDAC1 (Uniprot ID#P21796) |
Rabbit Polyclonal Anti-NOX2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal NOX2 antibody was raised against a 15 amino acid peptide near the amino terminus of human NOX2. |
Rabbit Polyclonal Anti-KCNH6 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCNH6 |
Rabbit Polyclonal Anti-ANGPTL3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ANGPTL3 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human ANGPTL3. |
ENaC Gamma Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide from human SCNN1G. |
Rabbit polyclonal SCNN1A Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SCNN1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 365-391 amino acids from the Central region of human SCNN1A. |
Rabbit anti-TPCN2 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | raised was raised against a peptide from N terminal residues of human TPCN2 protein |
Rabbit polyclonal Anti-KCNAB2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Rabbit polyclonal Connexin 43 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Connexin 43. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-NOX1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX1. |
Rabbit Polyclonal CLNS1A Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal antibody to CLIC3 (chloride intracellular channel 3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 236 of CLIC3 (Uniprot ID#O95833) |
Rabbit polyclonal antibody to chloride channel 5 (chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 62 and 393 of CLC-5 (Uniprot ID#P51795) |
Rabbit anti-CLCN1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CLCN1 |
Rabbit Polyclonal Anti-VDAC2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDAC2 antibody: A synthesized peptide derived from human VDAC2 |
VDAC1 (N-term) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human VDAC1. |
TNFAIP1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of Human TNFaIP1. |
Rabbit polyclonal antibody to SCNN1A (sodium channel, nonvoltage-gated 1 alpha)
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 182 and 459 of SCNN1A (Uniprot ID#P37088) |
Rabbit polyclonal anti-CLCN7 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CLCN7. |
Rabbit polyclonal anti-SCNN1D antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SCNN1D. |
Rabbit polyclonal anti-NOX5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX5. |
Rabbit polyclonal CACNA2D2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Rabbit polyclonal CLC4 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CLC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 663-689 amino acids from the C-terminal region of human CLC4. |
Rabbit polyclonal CLIC4 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CLIC4. |
Rabbit anti-GJA4 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GJA4 |
Rabbit anti-CLCN5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CLCN5 |
Rabbit anti-BEST1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BEST1 |
Rabbit Polyclonal Anti-CACNG1 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI |
Rabbit Polyclonal Anti-Connexin 26 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Connexin 26 Antibody: A synthesized peptide derived from the extracellular region of human Connexin 26 |
Rabbit Polyclonal Anti-Connexin 32 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Connexin 32 Antibody: A synthesized peptide derived from human Connexin 32 |
Rabbit Polyclonal Anti-AQP1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AQP1 Antibody: A synthesized peptide derived from human AQP1 |
Rabbit Polyclonal Anti-Connexin 43 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Connexin 43 Antibody: A synthesized peptide derived from human Connexin 43 |
Rabbit Polyclonal Anti-GJB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GJB2 antibody was raised against a 16 amino acid peptide near the center of human GJB2. |
Rabbit Polyclonal Anti-Trophinin Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Trophinin antibody was raised against a 16 amino acid peptide near the amino terminus of human Trophinin. |
Rabbit Polyclonal Anti-TNFAIP1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TNFAIP1 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human TNFAIP1. |
Rabbit Polyclonal Anti-CACNB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CACNB1 |
Rabbit Polyclonal CACNB2 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
GJA1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide mapping at the C-terminus of human Connexin 43 |
Rabbit Polyclonal KCTD15 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KCTD15 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human KCTD15. |
Rabbit Polyclonal antibody to CLCA1 (chloride channel accessory 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 542 and 633 of CLCA1 (Uniprot ID#A8K7I4) |
Rabbit polyclonal Connexin 43 (Ser265) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Connexin 43 around the phosphorylation site of Serine 265. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-AQP1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AQP1. |
Rabbit polyclonal anti-CLIC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLIC3. |
Rabbit polyclonal anti-CLCN4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLCN4. |
Rabbit polyclonal anti-CLNS1A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CLNS1A. |
Rabbit polyclonal anti-GJA3 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GJA3. |
Rabbit polyclonal anti-SCN7A antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SCN7A. |
Rabbit polyclonal anti-TNAP1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNAP1. |