Rabbit Polyclonal Anti-CYP1B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Cyp1b1 antibody is: synthetic peptide directed towards the middle region of human CYP1B1 |
Rabbit Polyclonal Anti-CYP1B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Cyp1b1 antibody is: synthetic peptide directed towards the middle region of human CYP1B1 |
Rabbit anti-CYP2E1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYP2E1 |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV |
Rabbit Polyclonal Anti-CYP2E1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
Rabbit Polyclonal Anti-CYP2C9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2C9 antibody: synthetic peptide directed towards the C terminal of human CYP2C9. Synthetic peptide located within the following region: AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV |
Rabbit polyclonal CYP1A2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
Rabbit anti-CYP1A1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYP1A1 |
Rabbit polyclonal Cytochrome P450 2E1 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 2E1. |
Modifications | Phospho-specific |
Rabbit polyclonal CYP2B6 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP2B6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-263 amino acids from the Central region of human CYP2B6. |
Rabbit polyclonal CYP2S1 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP2S1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 399-428 amino acids from the C-terminal region of human CYP2S1. |
Rabbit Polyclonal Anti-CYP3A7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI |
Rabbit Polyclonal Anti-CYP3A7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG |
Rabbit Polyclonal Anti-CYP2B6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL |
Rabbit Polyclonal Anti-CYP2C18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2C18 antibody: synthetic peptide directed towards the N terminal of human CYP2C18. Synthetic peptide located within the following region: MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM |
Rabbit Polyclonal Anti-Cytochrome P450 2B6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 2B6 Antibody: A synthesized peptide derived from human Cytochrome P450 2B6 |
Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2 |
Rabbit Polyclonal CYP1B1 Antibody
Applications | ELISA, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
USD 370.00
2 Weeks
Cytochrome P450 2C8 (CYP2C8) (+ 2C9, 2C18, 2C19) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 100-150 of Human CYP2C8. |
Cytochrome P450 3A4 (CYP3A4) (+ CYP3A5) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 351-400 of Human CYP3A4. |
CYP1A1 (+CYP1A2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 71-120 of Human CYP1A1. |
Rabbit polyclonal Cytochrome P450 2S1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2S1. |
Rabbit polyclonal Cytochrome P450 1A1/2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A1/2. |
Rabbit polyclonal Cytochrome P450 2B6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2B6. |
Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 2B6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Cytochrome P450 2B6. |
Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 2C8 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8. |
Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 1A2 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A2. |
Rabbit polyclonal anti-CP1B1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CP1B1. |
Rabbit polyclonal Cytochrome P450 3A7 antibody
Applications | WB |
Reactivities | Human |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A7. |
Rabbit polyclonal Cytochrome P450 2C8/9/18/19 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8/9/18/19. |
Rabbit polyclonal Cytochrome P450 3A4 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A4. |
Rabbit polyclonal CYP3A5 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP3A5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-502 amino acids from the C-terminal region of human CYP3A5. |
Rabbit polyclonal CYP2E1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP2E1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-429 amino acids from the C-terminal region of human CYP2E1. |
Rabbit Polyclonal Anti-CYP3A5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A5 antibody: synthetic peptide directed towards the N terminal of human CYP3A5. Synthetic peptide located within the following region: AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL |
Cytochrome P450 2E1 (CYP2E1) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Canine, Human, Mouse, Rat |
Immunogen | Synthetic peptide surrounding amino acid 405 of Human Cytochrome P450. |
Cytochrome P450 2E1 (CYP2E1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide mapping at the C-terminal of human P450ⅡE1 |
Rabbit polyclonal Cytochrome P450 3A4/5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A4/5. |
CYP2C18 (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2C18 |
Cytochrome P450 3A5 (CYP3A5) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CYP3A5 |
Rabbit Polyclonal Anti-CYP2S1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CYP2S1 Antibody: synthetic peptide directed towards the C terminal of human CYP2S1. Synthetic peptide located within the following region: MKYPHVQKWVREELNRELGAGQAPSLGDRTRLPYTDAVLHEAQRLLALVP |
Rabbit Polyclonal Anti-CYP3A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: KSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI |
Rabbit Polyclonal Anti-CYP3A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A1,CYP1A2) antibody
Reactivities | Rat |
Immunogen | Cytochrome P450 (CYP1A1,CYP1A2) |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A1) antibody
Reactivities | Rat |
Immunogen | Cytochrome P450 (CYP1A1) |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A2) antibody
Reactivities | Human |
Immunogen | Cytochrome P450 (CYP1A2) |
Rabbit polyclonal anti-Cytochrome P450 (CYP2E1) antibody
Reactivities | Human, Rat |
Immunogen | Cytochrome P450 (CYP2E1) |
Rabbit polyclonal anti-Cytochrome P450 (CYP3A4) antibody
Reactivities | Human |
Immunogen | Cytochrome P450 (CYP3A4) |
Anti-CYP1B1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human cytochrome P450, family 1, subfamily B, polypeptide 1 |
Anti-CYP1B1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human cytochrome P450, family 1, subfamily B, polypeptide 1 |
Anti-CYP1A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human cytochrome P450, family 1, subfamily A, polypeptide 1 |