ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
ERK1 (MAPK3) mouse monoclonal antibody, clone AT1A2, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
ERK1 (MAPK3) mouse monoclonal antibody, clone AT1A2, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
USD 355.00
2 Weeks
EGFR (Ligand binding Site) mouse monoclonal antibody, clone EGF-R1, Purified
Applications | ELISA, FC, IHC |
Reactivities | Human |
EGFR (Ligand bdg. Dom.) mouse monoclonal antibody, clone EGF-R1, Purified
Applications | ELISA, FC, IHC |
Reactivities | Human |
SMAD3 mouse monoclonal antibody, clone 2C12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
SMAD3 mouse monoclonal antibody, clone 7F3, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Rat |
JNK2 (MAPK9) (1-425) mouse monoclonal antibody, clone 1C1-3A8, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 1E1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 1A2, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 3B12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 1E2, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
EGFR mouse monoclonal antibody, clone AT2H8, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
EGFR mouse monoclonal antibody, clone AT2H8, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
Caspase 3 (CASP3) (p17) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GRB2 (C-term) goat polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Bat, Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
Immunogen | Synthetic peptide from C Terminus of human GRB2 - KLH conjugated |
AKT3 (119-133) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bat, Bovine, Canine, Chicken, Equine, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
Immunogen | Synthetic peptide from an internal region of human AKT3 (NP_005456.1; NP_859029.1) |
c-Myc (MYC) rabbit polyclonal antibody, Biotin
Applications | ELISA, IHC, WB |
Conjugation | Biotin |
Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
c-Myc (MYC) rabbit polyclonal antibody, HRP
Applications | ELISA, IHC, WB |
Conjugation | HRP |
Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
Mouse monoclonal Akt phospho S473 antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal IGF1 Receptor Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal PDGF Receptor beta Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Dishevelled 3 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Bcl2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal APC Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
USD 530.00
2 Weeks
EGFR pThr693 (incl. pos. control) mouse monoclonal antibody, clone 5F10, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 465.00
2 Weeks
ERK2 (MAPK1) (N-term) (incl. pos. control) mouse monoclonal antibody, clone 6H3, Biotin
Applications | ELISA, WB |
Reactivities | Canine, Human, Mouse, Rat |
Conjugation | Biotin |
USD 465.00
2 Weeks
MEK1 (MAP2K1) (incl. pos. control) mouse monoclonal antibody, clone 9G3, Purified
Applications | ELISA, WB |
Reactivities | Canine, Human, Mouse, Rat |
RAF1 (N-term) mouse monoclonal antibody, clone 540, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
RAF1 (N-term) mouse monoclonal antibody, clone 863, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
RAF1 (N-term) mouse monoclonal antibody, clone 163, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
EGFR rabbit polyclonal antibody, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 1189-1199 of human EGF receptor protein. |
Frizzled 2 (FZD2) goat polyclonal antibody, Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide from the internal region of the human protein sequence according to NP_001457.1 |
EGFR rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure recombinant Human EGFR. |
EGFR rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure recombinant Human EGFR. |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Immunogen | Highly pure recombinant Human EGFR. |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Immunogen | Highly pure recombinant Human EGFR. |
Mouse monoclonal anti-AKT1 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
AKT1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2B9
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700055 |