Rabbit Polyclonal CTTNBL1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CTTNBL1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CTTNBL1. |
Rabbit Polyclonal CTTNBL1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CTTNBL1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CTTNBL1. |
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Rabbit Polyclonal Anti-SF3A1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SF3A1 antibody: synthetic peptide directed towards the N terminal of human SF3A1. Synthetic peptide located within the following region: QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT |
Rabbit anti-SFRS1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SFRS1 |
Rabbit Polyclonal antibody to ALY (THO complex 4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 233 of ALY (Uniprot ID#Q86V81) |
Rabbit Polyclonal antibody to SART1 (squamous cell carcinoma antigen recognized by T cells)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 137 and 447 of SART1 (Uniprot ID#O43290) |
Rabbit polyclonal hnRNP C1/C2 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human hnRNP C1/C2. |
Rabbit polyclonal anti-TRA-2a antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TRA-2a. |
Mouse monoclonal Hsp70 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Canine, Chicken, Drosophilia, Carp, Guinea pig, Hamster, Monkey, Pig, Rabbit, Sheep |
Conjugation | Unconjugated |
Rabbit anti-HSPA1A Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | N term –peptide of human HSPA1A |
SFRS3 (SRSF3) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide from Human SFRS3. |
Rabbit polyclonal antibody to NHP2-like protein 1 (NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 128 of NHP2-like protein 1 (Uniprot ID#P55769) |
Rabbit Polyclonal antibody to HSPA6 (heat shock 70kDa protein 6 (HSP70B'))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 377 and 628 of HSPA6 (Uniprot ID#P17066) |
Rabbit polyclonal antibody to hnRNP C1/C2 (heterogeneous nuclear ribonucleoprotein C (C1/C2))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 142 of hnRNP C1/C2 |
Rabbit polyclonal anti-hnRNP G antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human hnRNP G. |
Rabbit Polyclonal Acinus Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Acinus antibody was raised against a 35 amino acid peptide near the center of human Acinus. The immunogen is located within amino acids 760 - 810 of Acinus. |
Rabbit Polyclonal SkiP Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SkiP antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human SkiP . |
Rabbit Polyclonal BCAS2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BCAS2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human BCAS2. |
Rabbit polyclonal antibody to SAP130 (splicing factor 3b, subunit 3, 130kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1154 and 1217 of SAP130 (Uniprot ID#Q15393) |
Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1) |
Rabbit polyclonal anti-hnRNP A1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from inetrnal of human hnRNP A1. |
Rabbit polyclonal anti-SFRS5 antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | he antiserum was produced against synthesized peptide derived from internal of human SFRS5. |
Rabbit Polyclonal Acinus Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Acinus antibody was raised against a peptide corresponding to amino acids near the C-terminus of the cleaved active peptide p17, which are identical to those of mouse Acinus. The immunogen is located within amino acids 1050 - 1100 of Acinus. |
Rabbit Polyclonal Acinus Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Acinus antibody was raised against a peptide corresponding to amino acids near the carbosy terminus of human AcinusL, which are identical to those of mouse Acinus. |
Rabbit polyclonal anti-SFRS3 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SFRS3. |
Rabbit Polyclonal NCBP1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NCBP1 antibody was raised against a 17 amino acid peptide near the center of human NCBP1. |