Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Rabbit Polyclonal Anti-SF3A1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SF3A1 antibody: synthetic peptide directed towards the N terminal of human SF3A1. Synthetic peptide located within the following region: QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT |
Rabbit anti-SFRS1 Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SFRS1 |
Rabbit Polyclonal antibody to SART1 (squamous cell carcinoma antigen recognized by T cells)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 137 and 447 of SART1 (Uniprot ID#O43290) |
Rabbit anti-HSPA1A Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | N term –peptide of human HSPA1A |
Rabbit polyclonal antibody to NHP2-like protein 1 (NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 128 of NHP2-like protein 1 (Uniprot ID#P55769) |
Rabbit polyclonal antibody to hnRNP C1/C2 (heterogeneous nuclear ribonucleoprotein C (C1/C2))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 142 of hnRNP C1/C2 |
Rabbit Polyclonal Acinus Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Acinus antibody was raised against a 35 amino acid peptide near the center of human Acinus. The immunogen is located within amino acids 760 - 810 of Acinus. |
Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1) |
Rabbit polyclonal anti-SFRS5 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized peptide derived from internal of human SFRS5. |
Rabbit Polyclonal Acinus Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Acinus antibody was raised against a peptide corresponding to amino acids near the C-terminus of the cleaved active peptide p17, which are identical to those of mouse Acinus. The immunogen is located within amino acids 1050 - 1100 of Acinus. |
Rabbit Polyclonal Acinus Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Acinus antibody was raised against a peptide corresponding to amino acids near the carbosy terminus of human AcinusL, which are identical to those of mouse Acinus. |
Active filters
Applications
- IF
Isotypes
- IgG
Pathways
- Spliceosome