Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 192 results

Page 1 of 4

(reset)

Arginase 1 (ARG1) Rabbit Polyclonal Antibody

TA308162

USD 415.00

In Stock

Rabbit Polyclonal antibody to Arginase I (arginase, liver)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 322 of Arginase I (Uniprot ID#P05089)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

iNOS (NOS2) Rabbit Polyclonal Antibody

TA314265

USD 345.00

4 Weeks

Rabbit polyclonal anti-iNOS antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human iNOS.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALDH2 Mouse Monoclonal Antibody [Clone ID: 138CT22.3.8]

TA324332

USD 450.00

2 Weeks

Mouse monoclonal ALDH2 Antibody

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody

TA590756

USD 409.00

In Stock

Rabbit Polyclonal FALDH Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody

TA308495

USD 415.00

5 Days

Rabbit polyclonal antibody to Argininosuccinate Lyase (argininosuccinate lyase)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 13 and 261 of ASL (Uniprot ID#P04424)

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Creatine kinase M type (CKM) Rabbit Polyclonal Antibody

TA313625

USD 345.00

In Stock

Rabbit polyclonal anti-CKM / M-CK antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from N-terminal of human M-CK.

1 / 3

2 / 3

3 / 3

Previous Next

GLS2 Rabbit Polyclonal Antibody

TA319893

USD 430.00

2 Weeks

Rabbit Polyclonal GLS2 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	GLS2 antibody was raised against a 18 amino acid synthetic peptide near the center terminus of human GLS2.

1 / 3

2 / 3

3 / 3

Previous Next

Glutaminase (GLS) Rabbit Polyclonal Antibody

TA325074

USD 450.00

5 Days

Rabbit polyclonal GLS Antibody (C-term)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This GLS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-545 amino acids from the C-terminal region of human GLS.

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ornithine aminotransferase (OAT) Rabbit Polyclonal Antibody

TA325081

USD 450.00

5 Days

Rabbit polyclonal OAT Antibody (N-term)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	This OAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-55 amino acids from the N-terminal region of human OAT.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody

TA308132

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to ASL (argininosuccinate lyase)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant protein fragment contain a sequence corresponding to a region within amino acids 86 and 325 of ASL

1 / 3

2 / 3

3 / 3

Previous Next

eNOS (NOS3) Rabbit Polyclonal Antibody

TA323615

USD 345.00

4 Weeks

Anti-NOS3 Rabbit Polyclonal Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide sequence around aa.1175~1179 (T-Q-S-F-S) derived from Human eNOS.

1 / 2

2 / 2

Previous Next

GLS2 Rabbit Polyclonal Antibody

TA336821

USD 479.00

5 Days

Rabbit Polyclonal GLS2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Antibody was raised against a 18 amino acid peptide near the center terminus of human GLS2 (NP_037399).

1 / 3

2 / 3

3 / 3

Previous Next

ALDH2 Rabbit Polyclonal Antibody

TA302017

USD 450.00

2 Weeks

Rabbit Polyclonal Antibody against ALDH2 (N-term)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.

1 / 2

2 / 2

Previous Next

Aminoacylase 1 (ACY1) Rabbit Polyclonal Antibody

TA308034

USD 415.00

5 Days

Rabbit polyclonal antibody to Aminoacylase-1 (aminoacylase 1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 89 and 366 of Aminoacylase 1 (Uniprot ID#Q03154)

1 / 3

2 / 3

3 / 3

Previous Next

Creatine kinase B type (CKB) Rabbit Polyclonal Antibody

TA308722

USD 415.00

5 Days

Rabbit Polyclonal antibody to Creatine kinase (brain) (creatine kinase, brain)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 165 and 381 of Creatine kinase (brain) (Uniprot ID#P12277)

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CKMT2 Rabbit Polyclonal Antibody

TA313626

USD 345.00

4 Weeks

Rabbit polyclonal anti-CKMT2 antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human CKMT2.

1 / 2

2 / 2

Previous Next

PYCR2 Rabbit Polyclonal Antibody

TA334474

USD 375.00

5 Days

Rabbit Polyclonal Anti-PYCR2 Antibody

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the middle region of human PYCR2. Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALDH2 Mouse Monoclonal Antibody [Clone ID: OTI4H2]

CF500615

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH2 mouse monoclonal antibody, clone OTI4H2 (formerly 4H2)

Applications	FC, IF
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody [Clone ID: OTI1F4]

CF500700

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]

CF501286

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ODC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: OTI1G1]

CF501546

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ODC1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI5B7]

CF501876

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI5B7 (formerly 5B7)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI4A10]

CF501877

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2B11]

CF501897

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2F11]

CF501898

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2A5]

CF501899

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2A12]

CF501900

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI3D1]

CF501901

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR3 Mouse Monoclonal Antibody [Clone ID: OTI3A8]

CF502032

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCRL mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR3 Mouse Monoclonal Antibody [Clone ID: OTI3E1]

CF502033

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCRL mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

PYCR3 Mouse Monoclonal Antibody [Clone ID: OTI1C11]

CF502034

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCRL mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PYCR3 Mouse Monoclonal Antibody [Clone ID: OTI2E10]

CF502035

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PYCRL mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PYCR3 Mouse Monoclonal Antibody [Clone ID: OTI8H6]

CF502036

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCRL mouse monoclonal antibody, clone OTI8H6 (formerly 8H6)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

PYCR3 Mouse Monoclonal Antibody [Clone ID: OTI3B9]

CF502077

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCRL mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PYCR3 Mouse Monoclonal Antibody [Clone ID: OTI1B12]

CF502078

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCRL mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

PYCR3 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

CF502121

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCRL mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI5C7]

CF502144

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI2G8]

CF503091

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI 1A7]

CF503095

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI 1A7 (formerly 1A7)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI5C12]

CF503096

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3A8]

CF503097

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI5F2]

CF503098

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5F2 (formerly 5F2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3C9]

CF503099

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI5E5]

CF503100

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI2H1]

CF503101

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI1G7]

CF503102

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI 5F9]

CF503112

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI 5F9 (formerly 5F9)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GATM Mouse Monoclonal Antibody [Clone ID: OTI1C9]

CF503147

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

GATM Mouse Monoclonal Antibody [Clone ID: OTI1E3]

CF503207

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SAT2 Mouse Monoclonal Antibody [Clone ID: OTI2A3]

CF504630

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SAT2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications	FC, IF, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 50 of 192 results

Page 1 of 4