Germany
Japan
United Kingdom
China
NKCC1 (SLC12A2) (769-783) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Canine, Chicken, Equine, Human, Porcine |
| Immunogen | Synthetic peptide from an internal region of human SLC12A2 / NKCC1 (NP_001037.1) |
Primary Antibodies
View as table Download
Rabbit Polyclonal Antibody against PRKCB1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This PKC beta2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-673 amino acids from the C-terminal region of human PKC beta2. |
Rabbit polyclonal PLCG1 (Tyr771) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-YP-G-A) |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-ATP6V1H antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP6V1H. |
Rabbit Polyclonal anti-GNAS antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
Rabbit Polyclonal Anti-PDIA4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDIA4 antibody: synthetic peptide directed towards the N terminal of human PDIA4. Synthetic peptide located within the following region: ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL |
Phospho-PLCG2-Y1217 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1217 of human PLCG2 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SLC12A2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SLC12A2 / NKCC1 antibody was raised against synthetic 19 amino acid peptide from N-terminus of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (89%); Monkey, Marmoset, Ferret, Dog, Panda (84%). |
Rabbit Polyclonal Anti-SLC12A2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SLC12A2 / NKCC1 antibody was raised against synthetic 18 amino acid peptide from internal region of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Bovine, Pig (89%); Ferret, Dog, Bat, Panda (83%). |
Rabbit Polyclonal Anti-SLC12A2 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SLC12A2 / NKCC1 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Ferret, Bovine, Dog, Bat, Hamster, Panda, Horse, Pig (100%); Elephant, Lizard (94%); Opossum, Chicken (88%); Turkey (82%). |
Rabbit Polyclonal Anti-SLC12A2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SLC12A2 / NKCC1 antibody was raised against synthetic 15 amino acid peptide from internal region of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Ferret, Elephant, Panda, Bovine, Dog, Horse, Pig, Opossum, Guinea pig (100%); Bat (93%). |
Carrier-free (BSA/glycerol-free) PDIA4 mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Anti-PRKCA rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha |
Anti-PRKACG Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 44-298 amino acids of human protein kinase, cAMP-dependent, catalytic, gamma |
Anti-MUC2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from human mucin 2, oligomeric mucus/gel-forming |
Anti-ARF1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 100-115 amino acids of Human ADP-ribosylation factor 1 |
Anti-GNAS Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus |
Active filters
Filter by
Target Symbol
- GNAS (32)
- PDIA4 (18)
- SHC1 (16)
- ATP6V1C2 (15)
- ATP6V1B1 (12)
- ATP6V1F (10)
- ACTB (9)
- PRKCA (9)
- SLC12A2 (7)
- ATP6V1B2 (6)
- ATP6V0D2 (5)
- ARF1 (4)
- CFTR (4)
- KCNQ1 (3)
- MUC2 (3)
- PLCG1 (3)
- TJP1 (3)
- ACTG1 (2)
- ATP6V1A (2)
- KDELR2 (2)
- PRKACA (2)
- PRKACG (2)
- PRKCB (2)
- PRKX (2)
- ADCY3 (1)
- ATP6V0A2 (1)
- ATP6V0B (1)
- ATP6V1D (1)
- ATP6V1H (1)
- KDELR3 (1)
- PLCG2 (1)
- PRKACB (1)
- PRKCG (1)
- SEC61A1 (1)
Reactivities
- Human (156)
- Mouse (121)
- Rat (117)
- Dog (19)
- Monkey (17)
- Bovine (8)
- Chicken (3)
- Pig (3)
- Porcine (3)
- Rhesus Monkey (3)
- Canine (2)
- Hamster (2)
- X. tropicalis (2)
- Xenopus (2)
- All Species (1)
- Avian (1)
- Bat (1)
- C. elegans (1)
- Chimpanzee (1)
- Drosophila (1)
- Fish (1)
- Guinea Pig (1)
- Primate (1)
- Rabbit (1)
- Sheep (1)
- Zebrafish (1)