Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
Rabbit Polyclonal AXIN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AXIN2 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human AXIN2. The immunogen is located within amino acids 780 - 830 of AXIN2. |
c-Myc (MYC) chicken polyclonal antibody, FITC
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. After repeated injections, immune eggs were collected, from which the IgY fractions were prepared. |
c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Immunogen | This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. |
EGF rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Immunogen | Recombinant EGF precursor from Suberites domuncula. |
EGF rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Immunogen | Recombinant EGF precursor from Suberites domuncula. |
EGF rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hEGF (human EGF). |
EGF rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hEGF (human EGF). |
c-Myc (MYC) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, WB |
| Conjugation | Biotin |
| Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
c-Myc (MYC) rabbit polyclonal antibody, HRP
| Applications | ELISA, IHC, WB |
| Conjugation | HRP |
| Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
Rabbit polyclonal FGF4 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-198 amino acids from the C-terminal region of human FGF4. |
WNT8A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Gorilla, Horse, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Panda, Horse (100%); Bovine, Dog (93%); Rabbit (86%). |
Anti-Human BMP-2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human BMP-2 |
Anti-Human FGF-4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human FGF-4 |
Anti-Human WNT-3a Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived recombinant Human WNT-3a. |
Rabbit Polyclonal Anti-WNT8A Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (93%); Bat, Dog, Bovine, Horse, Rabbit (86%). |
Anti-FGF4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 192-206 amino acids of Human fibroblast growth factor 4 |
Anti-BMP4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4 |
Anti-EGF Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor |
Rabbit Polyclonal Anti-AXIN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AXIN2 |
Rabbit Polyclonal Anti-WNT3A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human WNT3A |
Rabbit Polyclonal Anti-WNT8A Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human WNT8A |
Active filters
Applications
- IHC
Clonalities
- Polyclonal
Families
- Induced pluripotent stem cells
Pathways
- Pathways in cancer