Primary Antibodies

View as table Download

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)

Rabbit Polyclonal Anti-CXCL3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CXCL3

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CXCL14

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.

MCP-2 / CCL8 Mouse Monoclonal Antibody

Applications IHC
Reactivities Human

Rabbit Polyclonal Anti-CCL21 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CCL21

Rabbit Polyclonal CCL2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human CCL2.

Rabbit polyclonal IL8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8.

Mouse Monoclonal CCL2/MCP1 Antibody (2D8)

Applications ELISA, FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Anti-Human GRO-β Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GRO-β (CXCL2)

Anti-Human IP-10 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IP-10 (CXCL10)

CCL5 / RANTES Mouse Monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Anti-Human BRAK Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BRAK (CXCL14)

Anti-Human GRO/MGSA Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GRO/MGSA (CXCL1)

Anti-Human MIG Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MIG (CXCL9)

SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen E. Coli derived Recombinant recombinant Human SDF-1 beta

SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen E. Coli derived Recombinant recombinant Human SDF-1 beta

Rabbit polyclonal CCL2 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2.

Anti-Human IL-8 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-8 (72 a.a.) (CXCL8)

Anti-Human I-TAC Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human I-TAC (CXCL11)

Anti-Human MIP-3a Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MIP-3α (CCL20)

Anti-Human MIP-5 Goat Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MIP-5 (CCL15)

SDF1 (CXCL12) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human SDF-1.

PF4 sheep polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Human
Immunogen PF4 antibody was raised against platelet Factor 4 (PF4) purified from human platelet releasate.

Exodus 2 (CCL21) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 23-52 amino acids from the Central region of Human CCL21.

Rabbit Polyclonal antibody to PF4V1 (platelet factor 4 variant 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 40 and 104 of PF4V1 (Uniprot ID#P10720)

Rabbit Polyclonal CCL4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Rabbit polyclonal CCL4 antibody was raised against a 15 amino acid peptide near the center of human CCL4.

Rabbit Polyclonal CCL17 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL17 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human CCL17.

Rabbit Polyclonal CXCL12 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCL12 antibody was raised against a 16 amino acid peptide near the center of human CXCL12

Anti-Human CXCL16 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human CXCL16

Anti-Human ENA-78 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human ENA-78 (CXCL5) (5-78 a.a.)

Anti-Human Exodus-2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Exodus-2 (CCL21)

Anti-Human GRO-? Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GRO-γ (CXCL3)

Anti-Human MCP-1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MCP-1 (CCL2)

Anti-Human MEC Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MEC (CCL28)

Anti-Human PF-4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PF-4 (CXCL4)

Anti-Human RANTES Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human RANTES (CCL5)

Rabbit Polyclonal CX3CL1/Fractalkine Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human CX3CL protein (within residues 20-150). [Swiss-Prot P78423]

IL8 (CXCL8) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human

Macrophage Inflammatory Protein 3 alpha (CCL20) (33-44) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Peptide with sequence from the internal region of Human CCL20 (NP_004582.1; NP_001123518.1)

Macrophage Inflammatory Protein 3 alpha (CCL20) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bovine, Human, Porcine
Immunogen Peptide with sequence from the internal region of Human CCL20 (NP_004582.1; NP_001123518.1). 
Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (92%).

Rabbit polyclonal antibody to I-309 (chemokine (C-C motif) ligand 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 32 and 96 of I-309 (Uniprot ID#P22362)

Anti-Human Lymphotactin Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Lymphotactin (XCL1)

Rabbit Polyclonal Anti-CCL18 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL18 antibody: synthetic peptide directed towards the middle region of human CCL18. Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

CCL3 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human

Anti-Human Eotaxin Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Eotaxin (CCL11)