Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 81 results

Page 1 of 2

(reset)

CD13 (ANPEP) Rabbit Monoclonal Antibody [Clone ID: EPR4058]

TA307568

USD 520.00

In Stock

Rabbit monoclonal antibody against CD13(clone EPR4058)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

CD13 (ANPEP) Rabbit Polyclonal Antibody

AP20647PU-N

USD 370.00

2 Weeks

CD13 (ANPEP) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide, corresponding to amino acids 880-930 of Human CD13.

1 / 2

2 / 2

Previous Next

CD13 (ANPEP) Rabbit Polyclonal Antibody

TA332824

USD 275.00

3 Weeks

Rabbit anti-ANPEP Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ANPEP

Aminopeptidase A (ENPEP) Rabbit Polyclonal Antibody

TA590717

USD 409.00

In Stock

Rabbit Polyclonal Aminopeptidase A/APA Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 3

2 / 3

3 / 3

Previous Next

Aminopeptidase A (ENPEP) Goat Polyclonal Antibody

TA303036

USD 375.00

In Stock

Goat Polyclonal Antibody against ENPEP

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-EQYQKTSLAQEKEK, from the internal region of the protein sequence according to NP_001968.2.

1 / 2

2 / 2

Previous Next

Angiotensin Converting Enzyme 1 (ACE) Mouse Monoclonal Antibody [Clone ID: 4F3-E6-H8]

TA346871

USD 380.00

4 Weeks

Mouse Monoclonal Angiotensin Converting Enzyme 1 Antibody

Applications	WB
Reactivities	Mouse
Conjugation	Unconjugated

Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody

TA347909

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ACE1 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACE1 Antibody: A synthesized peptide derived from human ACE1

Aminopeptidase A (ENPEP) (689-032) Rabbit Polyclonal Antibody

AP23168PU-N

USD 440.00

2 Weeks

Aminopeptidase A (ENPEP) (689-032) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	Recombinant protein fragment containing a sequence corresponding to a region within amino acids 689 and 932 of Human ENPEP

1 / 3

2 / 3

3 / 3

Previous Next

Aminopeptidase A (ENPEP) (C-term) Rabbit Polyclonal Antibody

AP51433PU-N

USD 450.00

2 Weeks

Aminopeptidase A (ENPEP) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 906-938 amino acids from the C-terminal region of Human ENPEP.

1 / 3

2 / 3

3 / 3

Previous Next

Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody

AP20608PU-N

USD 407.00

2 Weeks

Angiotensin Converting Enzyme 1 (ACE) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

CD13 (ANPEP) Rabbit Polyclonal Antibody

TA343101

USD 375.00

5 Days

Rabbit Polyclonal Anti-ANPEP Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA

CD13 (ANPEP) Goat Polyclonal Antibody

TA329672

USD 375.00

5 Days

Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2

CD13 (ANPEP) Goat Polyclonal Antibody

TA329673

USD 375.00

5 Days

Goat Anti-CD13 / ANPEP Polyclonal Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1D1]

CF503914

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1D6]

CF503915

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI3E7]

CF503962

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI3E7 (formerly 3E7)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1C4]

CF503963

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1D4]

CF504037

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI3G1]

CF504054

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI3G1 (formerly 3G1)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1E3]

CF504071

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI4G8]

CF504251

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI4G8 (formerly 4G8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

CF807395

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2F10]

CF807396

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI3F8]

CF807397

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Angiotensin Converting Enzyme 1 (ACE) Mouse Monoclonal Antibody [Clone ID: OTI2C8]

CF812211

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACE mouse monoclonal antibody,clone OTI2C8

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Angiotensin Converting Enzyme 1 (ACE) Mouse Monoclonal Antibody [Clone ID: OTI2G5]

CF812212

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACE mouse monoclonal antibody,clone OTI2G5

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody

TA323566

USD 345.00

In Stock

Anti-ACE1 Rabbit Polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme

Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody

TA323567

USD 345.00

In Stock

Anti-ACE1 Rabbit Polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme

Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody

TA350853

USD 345.00

In Stock

Rabbit Polyclonal Anti-ACE Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human ACE

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1D1]

TA503914

USD 379.00

In Stock

ENPEP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]

TA503914AM

USD 420.00

4 Weeks

ENPEP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1), Biotinylated

Applications	FC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]

TA503914BM

USD 420.00

4 Weeks

ENPEP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1), HRP conjugated

Applications	FC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1D1]

TA503914S

USD 159.00

2 Days

ENPEP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1D6]

TA503915

USD 379.00

In Stock

ENPEP mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D6]

TA503915AM

USD 420.00

4 Weeks

ENPEP mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), Biotinylated

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D6]

TA503915BM

USD 420.00

4 Weeks

ENPEP mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1D6]

TA503915S

USD 159.00

2 Days

ENPEP mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI3E7]

TA503962

USD 379.00

In Stock

ENPEP mouse monoclonal antibody, clone OTI3E7 (formerly 3E7)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E7]

TA503962AM

USD 420.00

4 Weeks

ENPEP mouse monoclonal antibody, clone OTI3E7 (formerly 3E7), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E7]

TA503962BM

USD 420.00

4 Weeks

ENPEP mouse monoclonal antibody, clone OTI3E7 (formerly 3E7), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI3E7]

TA503962S

USD 159.00

2 Days

ENPEP mouse monoclonal antibody, clone OTI3E7 (formerly 3E7)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1C4]

TA503963

USD 379.00

In Stock

ENPEP mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C4]

TA503963AM

USD 420.00

4 Weeks

ENPEP mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C4]

TA503963BM

USD 420.00

4 Weeks

ENPEP mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1C4]

TA503963S

USD 159.00

2 Days

ENPEP mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1D4]

TA504037

USD 379.00

In Stock

ENPEP mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]

TA504037AM

USD 420.00

4 Weeks

ENPEP mouse monoclonal antibody, clone OTI1D4 (formerly 1D4), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D4]

TA504037BM

USD 420.00

4 Weeks

ENPEP mouse monoclonal antibody, clone OTI1D4 (formerly 1D4), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1D4]

TA504037S

USD 159.00

2 Days

ENPEP mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI3G1]

TA504054

USD 379.00

In Stock

ENPEP mouse monoclonal antibody, clone OTI3G1 (formerly 3G1)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

1 - 50 of 81 results

Page 1 of 2