Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit anti-MAVS Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MAVS |
Rabbit anti-IFNB1 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNB1 |
Rabbit anti-CCL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CCL5 |
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
USD 450.00
5 Days
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the N terminal of human VISA. Synthetic peptide located within the following region: ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH |
Rabbit Polyclonal Anti-CCL5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN |
Interferon beta (IFNB1) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human Interferon beta 1/IFNB1. |
Rabbit polyclonal anti-IP-10 antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant rat IP-10 |
Rabbit polyclonal MIP-1 beta antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human MIP-1β protein. |
Mouse Monoclonal MAVS Antibody (58N2B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
