Germany
Japan
United Kingdom
China
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
Primary Antibodies
View as table Download
HLAB (HLA-B) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 184-212 amino acids from the Central region of human HLA-B |
HLA DMB (HLA-DMB) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 103-133 amino acids from the Central region of human HLA class II DM beta / HLA-DMB |
hCG (CGA) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 74-103 amino acids from the C-terminal region of human TSH-alpha |
Goat Anti-FAS / CD95 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1. |
Rabbit polyclonal antibody to Interferon alpha-6 (interferon, alpha 6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 125 and 189 of interferon alpha 6 (Uniprot ID#P05013) |
Rabbit polyclonal antibody to Perforin 1 (perforin 1 (pore forming protein))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 9 and 214 of Perforin 1 (Uniprot ID#P14222) |
Rabbit polyclonal antibody to HLA-DRB1 (major histocompatibility complex, class II, DR beta 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 56 and 250 of HLA-DRB1 (Uniprot ID#P01912) |
Rabbit polyclonal antibody to HLA-DRB4 (major histocompatibility complex, class II, DR beta 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 266 of HLA DR beta (Uniprot ID#P13762) |
Goat Anti-HLA-DQA2 & HLA-DQA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QGLRSVGASRH, from the C Terminus of the protein sequence according to NP_064440.1; NP_002113.2. |
Rabbit polyclonal anti-CD40 antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 261 of human CD40 |
Rabbit polyclonal anti-IL-2 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed human IL-2 |
Rabbit polyclonal IL-2 antibody Peroxidase Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-2 protein. |
Rabbit polyclonal anti-IL-4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Peroxidase Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Biotin Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal anti-IL-10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The whole rabbit serum was prepared by repeated immunizations with human IL-10. |
Mouse monoclonal Thyroglobulin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Rabbit polyclonal HLA-DQB1 Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-DQB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-39 amino acids from the N-terminal region of human HLA-DQB1. |
Rabbit polyclonal IFNA4 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IFNA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 162-189 amino acids from the C-terminal region of human IFNA4. |
Rabbit polyclonal Anti-HLA-F Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN |
Rabbit polyclonal Anti-HLA-DQA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the N terminal of human HLA-DQA2. Synthetic peptide located within the following region: GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS |
Rabbit polyclonal Anti-HLA-DQA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the middle region of human HLA-DQA2. Synthetic peptide located within the following region: LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK |
Rabbit Polyclonal Anti-IFNA7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IFNA7 Antibody: synthetic peptide directed towards the N terminal of human IFNA7. Synthetic peptide located within the following region: RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ |
Rabbit Polyclonal Anti-IFNA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNA5 antibody: synthetic peptide directed towards the middle region of human IFNA5. Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY |
Rabbit Polyclonal Anti-TPO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPO antibody is: synthetic peptide directed towards the N-terminal region of Human TPO. Synthetic peptide located within the following region: GASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVS |
Rabbit Polyclonal Anti-IL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL |
Rabbit Polyclonal Anti-IL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC |
Rabbit Polyclonal Anti-IL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS |
Rabbit Polyclonal Anti-FAIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD |
Rabbit Polyclonal Anti-HLA-DPA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DPA1 antibody: synthetic peptide directed towards the middle region of human HLA-DPA1. Synthetic peptide located within the following region: EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT |
Rabbit Polyclonal Anti-IFNA13 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-IFNA13 antibody: synthetic peptide directed towards the C terminal of human IFNA13. Synthetic peptide located within the following region: ILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
Rabbit Polyclonal Anti-IFNA16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNA16 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA16. Synthetic peptide located within the following region: ILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD |
Rabbit Polyclonal Anti-IFNA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNA4 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA4. Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
Rabbit Polyclonal Anti-HLA-DMA Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-HLA-DMA antibody: synthetic peptide directed towards the N terminal of human HLA-DMA. Synthetic peptide located within the following region: GLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEW |
Rabbit Polyclonal Anti-HLA-DOB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DOB antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-DOB. Synthetic peptide located within the following region: LTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVR |
Mouse Monoclonal FAS (C-terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Applications
- WB
Pathways
- Autoimmune thyroid disease
Filter by
Category
Target Symbol
- CD80 (88)
- TG (66)
- CD40 (60)
- CD86 (57)
- CTLA4 (29)
- IL2 (21)
- CD28 (19)
- FAS (17)
- HLA-A (17)
- SMURF2 (17)
- GZMB (13)
- HLA-DQA2 (13)
- IL4 (13)
- IL10 (11)
- IFNA2 (7)
- FASLG (6)
- HLA-DRB5 (6)
- IFNA6 (6)
- CD40LG (5)
- HLA-G (5)
- TSHR (5)
- IL5 (4)
- PRF1 (4)
- TPO (4)
- CGA (3)
- HLA-DMB (3)
- HLA-DRA (3)
- HLA-B (2)
- HLA-DMA (2)
- HLA-DOA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DPB1 (2)
- HLA-DRB3 (2)
- HLA-E (2)
- HLA-F (2)
- IFNA16 (2)
- IFNA4 (2)
- HLA-C (1)
- HLA-DQA1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
- IFNA13 (1)
- IFNA5 (1)
- IFNA7 (1)
- IFNA8 (1)
- TSHB (1)