Primary Antibodies

View as table Download

Rabbit anti-CBX5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CBX5

Rabbit Polyclonal HP1alpha/beta/gamma Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HP1.,.,. antibody: human HP1 . (Heterochromatin protein 1 homolog beta), using the full length recombinant GST tagged protein. The antibody also recognizes the . and . isoforms.

Rabbit Polyclonal HP1alpha Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HP1. antibody: human HP1. (Heterochromatin protein 1 homolog alpha), using the full length recombinant GST tagged protein.

Rabbit polyclonal HP1 alpha (Ab-92) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human HP1 alpha around the phosphorylation site of serine 92 (R-K-SP-N-F).

Rabbit Polyclonal HP1 alpha Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HP1 alpha antibody: human HP1 alpha (Heterochromatin protein 1 homolog alpha), using the full length recombinant GST tagged protein.

Rabbit Polyclonal HP1 alpha, beta and gamma Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HP1 alpha, beta and gamma antibody: human HP1 beta (Heterochromatin protein 1 homolog beta), using the full length recombinant GST tagged protein. The antibody also recognizes the alpha and gamma isoforms.

Rabbit polyclonal CBX5 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CBX5.

Goat Polyclonal Antibody against CBX5 / HP1-Alpha

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NKRKSNFSNSADDIK, from the internal region of the protein sequence according to NP_036249.1.

Rabbit Polyclonal Anti-CBX5 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBX5 antibody: synthetic peptide directed towards the middle region of human CBX5. Synthetic peptide located within the following region: KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFE

Rabbit Polyclonal Antibody against HP 1 alpha

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide containing an N-terminal region of human HP 1 alpha (within residues 1-100). [Swiss-Prot P45973]

Anti-CBX5 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-CBX5 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

HP1 alpha/CBX5 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1).
Modifications Unmodified

HP1 alpha/CBX5 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1).
Modifications Unmodified

HP1 alpha Mouse monoclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HP1 alpha Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human HP1 alpha