Primary Antibodies

View as table Download

IL-4 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI8D4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700022

lL-10 Rat monoclonal antibody, ELISA and Luminex validated, clone OTI9D7

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700017

CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700027

Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Azide Free

Applications FC, FN
Reactivities Human

IL10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10.

IL5 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 61-110 of Human IL-5

Mouse Monoclonal Anti-IL-2 Antibody [Clone ID: B-G5]

Reactivities Human
Conjugation Unconjugated

IL10 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084)

Rabbit polyclonal anti-CD40 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human CD40.

Rabbit polyclonal anti-IL-2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-2 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-2 protein.

IL2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human IL2

IL10 mouse monoclonal antibody, clone B-S10, Azide Free

Applications ELISA, FN
Reactivities Human

CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L

Rabbit anti-CGA Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CGA

Anti-Human IL-5 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-5

Rabbit Polyclonal Anti-FASL Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FASL Antibody: A synthesized peptide derived from human FASL

Rabbit Polyclonal Anti-Interleukin 2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 2 Antibody: A synthesized peptide derived from human Interleukin 2

Rabbit Polyclonal Anti-Interleukin 4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4

USD 320.00

In Stock

Goat Polyclonal Anti-IL10 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human IL10 produced in E. coli.

CD40 mouse monoclonal antibody, clone B-B20, Azide Free

Applications FC, FN, IHC
Reactivities Human

CD40 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40

IL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIL-4 (human IL-4)

IL10 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084)

Rabbit polyclonal anti-FAS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.

Rabbit polyclonal FAS ligand antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FAS ligand.

Mouse Anti-Human CD40 Purified (100 ug)

Reactivities Human
Conjugation Unconjugated

FAS Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FAS

Anti-Human IL-4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-4

Anti-Human IL-10 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-10

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

Rabbit Polyclonal Anti-CD40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD

Rabbit Polyclonal Anti-CD40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV

Rabbit Polyclonal Anti-Interleukin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5

Rabbit Polyclonal Anti-FAS ligand Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAS ligand Antibody: A synthesized peptide derived from human FAS ligand

Rabbit Polyclonal Fas Ligand Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the C Terminus Region

Rabbit Polyclonal Fas Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

IL2 mouse monoclonal antibody, clone B-G5, Azide Free

Applications FC, FN, WB
Reactivities Human

IL10 mouse monoclonal antibody, clone BN-10, FITC

Applications FC, IHC
Reactivities Human
Conjugation FITC

IL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIL-4 (human IL-4)

Rabbit Polyclonal antibody to interferon alpha 2 (interferon, alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 125 and 188 of Interferon alpha 2 (Uniprot ID#P01563)

Rabbit polyclonal anti-IL4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human IL4.

Mouse Anti-Human CD95 (APO-1/Fas) Purified

Applications FC
Reactivities Human

Rabbit polyclonal IL4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.

Anti-Human IL-2 Goat Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-2

Anti-Human IL-2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-2

Rabbit Polyclonal Fas Ligand Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

TSH beta (TSHB) mouse monoclonal antibody, clone TSH-116, Aff - Purified

Applications ELISA, R
Reactivities Human

Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Purified

Applications FC
Reactivities Human

TSH beta (TSHB) (intact) mouse monoclonal antibody, clone B31, Purified

Applications ELISA, Labeling
Reactivities Human