Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Rabbit Polyclonal Anti-Insulin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin

Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P).
Modifications Phospho-specific

Rabbit anti-NR5A2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR5A2

Rabbit Polyclonal Anti-PKLR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE

Rabbit Polyclonal Anti-SLC2A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC2A2 antibody: synthetic peptide directed towards the N terminal of human SLC2A2. Synthetic peptide located within the following region: ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST

Anti-HNF4A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 241-254 amino acids of human hepatocyte nuclear factor 4, alpha

Rabbit Polyclonal Glut2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human GLUT2 protein (between residues 50-150) [UniProt P11168]

Goat Polyclonal Anti-cardiac troponin T (aa201-213) Antibody

Applications WB
Reactivities Human, Mouse, Pig (Expected from sequence similarity: Feline, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-cardiac troponin T (aa201-213) Antibody: Peptide with sequence C-TERKSGKRQTERE, from the internal region of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1.

Rabbit polyclonal antibody to HNF-1 alpha (HNF1 homeobox A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 35 and 268 of HNF1 alpha (Uniprot ID#P20823)

Rabbit polyclonal NeuroD1 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1.

HNF 4 alpha (HNF4A) (2-15) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Canine, Equine, Hamster, Human, Monkey, Porcine, Rabbit
Immunogen Synthetic peptide from the N-terminus of human HNF4A / HNF4 (NP_849180.1; NP_000448.3; NP_849181.1)

Rabbit polyclonal HNF4A Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A.

Goat Polyclonal Antibody against HNF4A

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RLSKTLVDMDMADY-C, from the N Terminus of the protein sequence according to NP_849180.1; NP_000448.3; NP_849181.1.

GLUT2 Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen SLC2A2 / GLUT2 antibody was raised against synthetic peptide C-RKEREEASSEQKVS from an internal region of human SLC2A2 / GLUT2 (NP_000331.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Panda, Bat, Rabbit, Horse, Pig (93%); Rat, Sheep, Elephant, Dog, Bovine (86%).

Rabbit polyclonal GCK Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GCK.

Rabbit anti-HNF4A Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human HNF4A

Rabbit Polyclonal Anti-MNX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MNX1 antibody: synthetic peptide directed towards the N terminal of human MNX1. Synthetic peptide located within the following region: AAASGTGGGGGGGGASGGTSGSCSPASSEPPAAPADRLRAESPSPPRLLA

Rabbit Polyclonal MNX1/HLXB9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acids 330-380 of mouse HB9 was used as the immunogen.

Rabbit Polyclonal Anti-HHEX Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HHEX antibody: synthetic peptide directed towards the C terminal of human HHEX. Synthetic peptide located within the following region: DQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKS

Rabbit Polyclonal Anti-IAPP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IAPP antibody: synthetic peptide directed towards the N terminal of human IAPP. Synthetic peptide located within the following region: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV

Rabbit Polyclonal Anti-Neuro D Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Neuro D Antibody: A synthesized peptide derived from human Neuro D

Rabbit Polyclonal Anti-HNF4alpha /gamma Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF4alpha /gamma Antibody: A synthesized peptide derived from human HNF4alpha /gamma

Rabbit Polyclonal Anti-HNF-1β(TCF-2) Antibody 

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF-1β(TCF-2) Antibody: Peptide sequence around aa.252~256(R-Q-K-N-P) derived from Human HNF-1b(TCF-2).
INS

USD 320.00

In Stock

Goat Polyclonal Anti-INS Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human Insulin produced in E. coli as a fusion protein.

HES1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide.
Epitope: N-Terminus

PAX6 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant protein from human PAX6

Goat Polyclonal Antibody against TCF2 / VHNF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QAYDRQKNPSKEER, from the internal region of the protein sequence according to NP_000449.1; NP_006472.1.

Rabbit Polyclonal antibody to Pyruvate Kinase (liver/RBC) (pyruvate kinase, liver and RBC)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 260 of Pyruvate Kinase (liver/RBC) (Uniprot ID#P30613)

Anti-HNF1A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 57-70 amino acids of human HNF1 homeobox A

Rabbit Polyclonal HNF4 alpha (Ser313) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HNF4 alpha around the phosphorylation site of Serine 313
Modifications Phospho-specific

Rabbit Polyclonal anti-HHEX antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HHEX antibody: synthetic peptide directed towards the middle region of human HHEX. Synthetic peptide located within the following region: KQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQED

Rabbit Polyclonal Anti-HNF4A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the middle region of human HNF4A. Synthetic peptide located within the following region: RGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV

Rabbit Polyclonal Anti-HNF1A

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Insulin (INS) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Bovine, Porcine, Rat
Conjugation Unconjugated

HNF 4 alpha (HNF4A) (+ gamma) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 100-150 of Human HNF4α.

Insulin (INS) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HNF 4 alpha (HNF4A) (N-term) rabbit polyclonal antibody, Purified

Applications IF, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 116~145 amino acids from the N-terminal region of human HNF4 alpha / TCF14

Insulin (INS) (+Proinsulin) guinea pig polyclonal antibody, Serum

Applications IF, IHC
Reactivities Hamster, Human, Porcine, Rat
Immunogen Synthetic Human proinsulin

Anti-HNF1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A

Rabbit polyclonal HNF1A Antibody (Center)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This HNF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 177-205 amino acids from the Central region of human HNF1A.

Rabbit Polyclonal HNF4 alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HNF4 alpha

Rabbit Polyclonal Anti-HNF4G Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF4G antibody: synthetic peptide directed towards the C terminal of human HNF4G. Synthetic peptide located within the following region: MSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL

Rabbit Polyclonal Anti-PAX6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX6 antibody: synthetic peptide directed towards the N terminal of human PAX6. Synthetic peptide located within the following region: LAHSGARPCDISRILQTHADAKVQVLDNQNVSNGCVSKILGRYYETGSIR

PAX6 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human PAX6

Hex (HHEX) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human HHEX (24-39aa)

Insulin (INS) sheep polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Immunogen C-Peptide conjugate EAEDLQVGQVKKKC- KLH

Insulin (INS) sheep polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Immunogen C-Peptide conjugate EAEDLQVGQVKKKC- KLH

HNF1 beta (HNF1B) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 505-536 amino acids from the C-terminal region of human HNF1B

MAFA (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 209~238 amino acids from the Central region of Human MAFA.