Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit Polyclonal PPARG Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
Rabbit polyclonal GR (Ab-211) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Anti-HNF4A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 241-254 amino acids of human hepatocyte nuclear factor 4, alpha |
Rabbit Polyclonal antibody to Retinoic Acid Receptor gamma (retinoic acid receptor, gamma)
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 119 and 454 of Retinoic Acid Receptor gamma |
Rabbit polyclonal NURR1 (NR4A2) Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This NURR1 (NR4A2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human NURR1 (NR4A2). |
Rabbit anti-PPARD Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPARD |
Rabbit Polyclonal Anti-RARB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RARB |
Rabbit Polyclonal antibody to COUP TF1 (nuclear receptor subfamily 2, group F, member 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 44 of COUP TF1 (Uniprot ID#P10589) |
Rabbit polyclonal HNF4A Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A. |
Rabbit Polyclonal AhR (Ser36) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AhR around the phosphorylation site of Serine 36 |
| Modifications | Phospho-specific |
Rabbit anti-PTGES3 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PTGES3 |
Rabbit polyclonal Estrogen Receptor-a (Ab-537) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
Rabbit polyclonal Estrogen Receptor-a (Tyr537) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ER-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal AhR (Ser36) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AhR around the phosphorylation site of serine 36 (N-P-SP-K-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal GR (Ab-226) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 226/234/246 (L-L-S-P-L). |
Rabbit polyclonal GR (Ser226) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GR around the phosphorylation site of serine 226 (L-L-SP-P-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal RARA Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This RARA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-349 amino acids from the C-terminal region of human RARA. |
Rabbit polyclonal ESRRA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ESRRA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 131-159 amino acids from the Central region of human ESRRA. |
Rabbit Polyclonal AhR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AhR |
Rabbit anti-THRB Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human THRB |
Rabbit anti-NR1H3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NR1H3 |
Rabbit anti-ESR2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ESR2 |
Rabbit anti-PGRMC1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGRMC1 |
Rabbit Polyclonal Anti-NR1H4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H4 antibody: synthetic peptide directed towards the middle region of human NR1H4. Synthetic peptide located within the following region: AECLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCREKT |
Rabbit Polyclonal ERR alpha/NR3B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of human Estrogen Related Receptor alpha (within residues 1-50). [Swiss-Prot# P11474] |
Rabbit Polyclonal Anti-RXRG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT |
Rabbit Polyclonal Anti-Retinoic Acid Receptor beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Retinoic Acid Receptor beta Antibody: A synthesized peptide derived from human Retinoic Acid Receptor beta |
Rabbit Polyclonal Anti-NR4A3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A3 Antibody: A synthesized peptide derived from human NR4A3 |
Rabbit Polyclonal Anti-THR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THR1 Antibody: A synthesized peptide derived from human THR1 |
Rabbit Polyclonal Anti-HNF4alpha /gamma Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4alpha /gamma Antibody: A synthesized peptide derived from human HNF4alpha /gamma |
Rabbit Polyclonal Anti-Phospho-Retinoic Acid Receptor alpha (Ser77) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-Retinoic Acid Receptor alpha (Ser77) Antibody: A synthesized peptide derived from human Retinoic Acid Receptor alpha around the phosphorylation site of Sersine 77 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against RXRA
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CQVNSSLTSPTGRGSM, from the internal region of the protein sequence according to NP_002948.1. |
Active filters
Reactivities
- Mouse
Clonalities
- Polyclonal
Families
- Nuclear Hormone Receptor
Filter by
Category
Target Symbol
- ESR1 (19)
- NR3C1 (17)
- AR (8)
- PPARG (8)
- THRB (7)
- AHR (6)
- HNF4A (6)
- RARA (6)
- ESR2 (5)
- NR1H3 (5)
- NR4A1 (5)
- RARB (5)
- PGR (4)
- VDR (4)
- ESRRG (3)
- MED1 (3)
- NR2F2 (3)
- NR4A2 (3)
- NR4A3 (3)
- PPARD (3)
- PTGES3 (3)
- RARG (3)
- RORA (3)
- RXRB (3)
- RXRG (3)
- THRA (3)
- ESRRA (2)
- ESRRB (2)
- HNF4G (2)
- NR1H2 (2)
- NR2C2 (2)
- NR2E3 (2)
- NR2F1 (2)
- NR5A2 (2)
- PGRMC1 (2)
- PPARA (2)
- TRIP4 (2)
- NR0B1 (1)
- NR1D1 (1)
- NR1H4 (1)
- NR1I3 (1)
- NR2C1 (1)
- NR2F6 (1)
- PGRMC2 (1)
- RORB (1)
- RXRA (1)
Antibody Hosts
Isotypes
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (37)
- Neuroactive ligand-receptor interaction (27)
- PPAR signaling pathway (25)
- Thyroid cancer (15)
- Non-small cell lung cancer (12)
- Oocyte meiosis (12)
- Small cell lung cancer (12)
- Maturity onset diabetes of the young (10)
- Acute myeloid leukemia (9)
- Adipocytokine signaling pathway (9)
- Huntington's disease (8)
- Prostate cancer (8)
- MAPK signaling pathway (5)
- Progesterone-mediated oocyte maturation (4)
- Wnt signaling pathway (3)
- Circadian rhythm - mammal (1)