Germany
Japan
United Kingdom
China
Rabbit polyclonal PARP (Cleaved-Gly215) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PARP. |
Primary Antibodies
View as table Download
Rabbit polyclonal anti-POLE antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLE1. |
Rabbit polyclonal anti-PARP3 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PARP3. |
Rabbit polyclonal anti-NEIL3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NEIL3. |
Rabbit polyclonal anti-POLE4 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLE4. |
Rabbit Polyclonal C-RAF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human C-RAF |
Rabbit polyclonal APEX1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APEX1. |
Rabbit Polyclonal HMGB1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human HMGB1. |
Rabbit Polyclonal Anti-PARP2 Antibody
| Applications | IF, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA |
Rabbit Polyclonal MYH Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
PARP1 (N-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide for the N-terminal region of human PARP. |
Rabbit polyclonal antibody to DNA pol delta cat (polymerase (DNA directed), delta 1, catalytic subunit 125kDa)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 685 and 1071 of DNA pol delta cat (Uniprot ID#P28340) |
Rabbit polyclonal anti-POLD1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD1. |
Rabbit polyclonal anti-TDG antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TDG. |
Rabbit polyclonal anti-PARP2 antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PARP2. |
Anti-OGG1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit polyclonal FEN1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FEN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-272 amino acids from the Central region of human FEN1. |
Rabbit polyclonal POLE3 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This POLE3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 5-34 amino acids from the N-terminal region of human POLE3. |
Rabbit polyclonal PARP (Cleaved-Asp214) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PARP. |
Rabbit Polyclonal Anti-PARP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARP3 antibody: synthetic peptide directed towards the C terminal of human PARP3. Synthetic peptide located within the following region: LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP |
Rabbit Polyclonal UNG Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | This antibody was generated by immunizing rabbit with a synthetic peptide sequence CRHFSKTNELLQKSGKKP corresponding to amino acids 281-298 of human UNG1 (NP 003353.1) and amino acids 290-307 of human UNG2 (NP 550433.1). The peptide sequence used for imm |
Rabbit Polyclonal Anti-MBD4 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD4 antibody: synthetic peptide directed towards the middle region of human MBD4. Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT |
OGG1 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human OGG1 |
Thymine DNA glycosylase (TDG) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TDG |
Thymine DNA glycosylase (TDG) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human TDG |
POLD1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
DNA Ligase I (LIG1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human DNA ligase 1 |
DNA Ligase III (LIG3) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 792-822 amino acids from the C-terminal region of Human DNA ligase 3 |
NEIL1 (Center) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 137~167 amino acids from the Central region of human NEIL1 |
NTH1 (NTHL1) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 95-126 amino acids from the Central region of human NTHL1 |
DNA Polymerase lambda (POLL) (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 546~575 amino acids from the C-terminal region of human DNA polymerase lambda. |
Goat Polyclonal Antibody against MUTYH
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HISTDAHSLNSAAQ, from the C Terminus of the protein sequence according to NP_036354.1; NP_001041636.1; NP_001041637.1; NP_001041638.1; NP_001041639.1. |
Goat Polyclonal Antibody against MPG
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SVVDRVAEQDTQA, from the C Terminus of the protein sequence according to NP_002425.2; NP_001015052.1; NP_001015054.1. |
Goat Anti-NEIL1 / NEH1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DIPSLEPEGTSAS, from the C Terminus of the protein sequence according to NP_078884.2. |
Goat Anti-POLL / BETA-N Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LGLPYREPAERDW, from the C Terminus of the protein sequence according to NP_037406.1. |
Goat Anti-LIG1 / DNA ligase I Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RVREDKQPEQATTS, from the internal region (near C-Terminus) of the protein sequence according to NP_000225.1. |
Rabbit polyclonal anti-NEIL1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NEIL1. |
Active filters
Clonalities
- Polyclonal
Pathways
- Base excision repair