Rabbit Polyclonal Anti-MCM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the middle region of human MCM4. Synthetic peptide located within the following region: VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE |
Rabbit Polyclonal Anti-MCM7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the N terminal of human MCM7. Synthetic peptide located within the following region: MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYV |
Rabbit Polyclonal Anti-MCM5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM5 antibody: synthetic peptide directed towards the N terminal of human MCM5. Synthetic peptide located within the following region: MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG |
Rabbit Polyclonal Anti-MCM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the N terminal of human MCM4. Synthetic peptide located within the following region: SRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSL |
Rabbit Polyclonal Anti-MCM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the C terminal of human MCM4. Synthetic peptide located within the following region: KEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRAL |
Rabbit Polyclonal Anti-MCM7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the middle region of human MCM7. Synthetic peptide located within the following region: LSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVI |
Rabbit Polyclonal Anti-MCM7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MCM7 antibody is: synthetic peptide directed towards the N-terminal region of Human MCM7. Synthetic peptide located within the following region: KYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAV |
Rabbit polyclonal Anti-Rfc1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rfc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rfc1. Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG |
Rabbit polyclonal Anti-RFC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFC1 antibody: synthetic peptide directed towards the middle region of human RFC1. Synthetic peptide located within the following region: AQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSL |
Rabbit polyclonal Anti-RPA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPA1 antibody: synthetic peptide directed towards the middle region of human RPA1. Synthetic peptide located within the following region: SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI |
Rabbit polyclonal Anti-RPA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPA1 antibody: synthetic peptide directed towards the middle region of human RPA1. Synthetic peptide located within the following region: TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA |
Rabbit anti PCNA Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti MCM5 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-PCNA (aa111-122), Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EAPNQEKVSDYE., from the internal region of the protein sequence according to NP_002583.1. |
Anti-PCNA Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 9-252 amino acids of Human Proliferating cell nuclear antigen |
Anti-MCM4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 837-850 amino acids of Human minichromosome maintenance complex component 4 |
Anti-MCM3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human minichromosome maintenance complex component 3 |
Rabbit Polyclonal Anti-RPA2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
POLD3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MRPL40 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
