ADH5 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human ADH5 |
ADH5 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human ADH5 |
CYP2A13 (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2A13 |
CYP2C18 (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2C18 |
Cytochrome P450 3A5 (CYP3A5) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CYP3A5 |
CYP26A1 (485-496) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human CYP26A1 (NP_000774.2; NP_476498.1) |
BCMO1 (BCO1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 270-300 amino acids from the Central region of human BCMO1 |
DGAT2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human DGAT2. |
DHRS3 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 92~121 amino acids from the Center region of human DHRS3 |
Goat Polyclonal Antibody against ALDH1A1 (Internal)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RELGEYGFHEYTE, from the internal region of the protein sequence according to NP_000680.2. |
Goat Polyclonal Antibody against ALDH1A1 (C Terminus)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EVKTVTVKISQKNS, from the C Terminus of the protein sequence according to NP_000680.2. |
Goat Polyclonal Antibody against ADH1A, B, C
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence STAGKVMKCKA, from the N Terminus of the protein sequence according to NP_000658.1; NP_000659.2; NP_000660.1. |
Goat Anti-ADH5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KKIKVDEFVTHN, from the internal region of the protein sequence according to NP_000662.3 . |
Rabbit Polyclonal antibody to UGT2B7 (UDP glucuronosyltransferase 2 family, polypeptide B7)
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 278 of UGT2B7 (Uniprot ID#P16662) |
Rabbit Polyclonal DGAT1 Antibody
Applications | WB |
Reactivities | Bovine, Goat, Human, Mouse, Primate, Rat, Sheep, Zebrafish |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide within an internal region (residues 200-300) of the human DGAT1 protein. [Swiss-Prot# O75907] |
Goat Anti-CYP26B1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SQARSEDKDGRFH, from the internal region of the protein sequence according to NP_063938.1. |
Rabbit polyclonal anti-ADH7 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADH7. |
Rabbit polyclonal Cytochrome P450 3A43 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A43. |
Rabbit polyclonal anti-CP26C antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CP26C. |
Rabbit polyclonal anti-DGAT1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 308 of mouse DGAT-1 |
Rabbit Polyclonal anti-UGT1A9 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A9 antibody: synthetic peptide directed towards the N terminal of human UGT1A9. Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV |
Goat Anti-cytochrome P450 1A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQEKQLDENANVQ, from the internal region of the protein sequence according to NP_000490.1 |
Rabbit polyclonal Anti-UGT1A5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A5 antibody: synthetic peptide directed towards the N terminal of human UGT1A5. Synthetic peptide located within the following region: EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM |
Rabbit Polyclonal Anti-DGAT2L4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGAT2L4 antibody: synthetic peptide directed towards the C terminal of human DGAT2L4. Synthetic peptide located within the following region: GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII |
Rabbit Polyclonal Anti-DHRS9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHRS9 antibody: synthetic peptide directed towards the middle region of human DHRS9. Synthetic peptide located within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV |
Rabbit Polyclonal Anti-RDH8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RDH8 antibody is: synthetic peptide directed towards the middle region of Human RDH8. Synthetic peptide located within the following region: FDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKF |
Rabbit Polyclonal Anti-UGT2B4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4. Synthetic peptide located within the following region: NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE |
Rabbit Polyclonal Anti-CYP3A43 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the middle region of human CYP3A43. Synthetic peptide located within the following region: ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII |
Rabbit Polyclonal Anti-CYP3A43 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the C terminal of human CYP3A43. Synthetic peptide located within the following region: IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR |
Rabbit Polyclonal Anti-UGT2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the N terminal of human UGT2A3. Synthetic peptide located within the following region: NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN |
Rabbit Polyclonal Anti-UGT2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the middle region of human UGT2A3. Synthetic peptide located within the following region: GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR |
Rabbit Polyclonal Anti-RDH12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RDH12 antibody: synthetic peptide directed towards the middle region of human RDH12. Synthetic peptide located within the following region: HIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAV |
Rabbit Polyclonal Anti-RDH12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RDH12 antibody: synthetic peptide directed towards the middle region of human RDH12. Synthetic peptide located within the following region: AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT |
Rabbit Polyclonal Anti-CYP3A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: KSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI |
Rabbit Polyclonal Anti-CYP3A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG |
Rabbit Polyclonal Anti-ADH5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADH5 antibody: synthetic peptide directed towards the middle region of human ADH5 |
Rabbit Polyclonal Anti-UGT1A4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK |
Rabbit Polyclonal Anti-TMEM158 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMEM158 antibody: synthetic peptide directed towards the middle region of human TMEM158. Synthetic peptide located within the following region: AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR |
Rabbit Polyclonal Anti-ALDH1A2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Aldh1a2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Aldh1a2. Synthetic peptide located within the following region: ALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEV |
Rabbit Polyclonal Anti-ALDH1A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH1A2 antibody: synthetic peptide directed towards the N terminal of human ALDH1A2. Synthetic peptide located within the following region: PVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRL |
Rabbit Polyclonal Anti-CYP2A6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2A6 antibody: synthetic peptide directed towards the C terminal of human CYP2A6. Synthetic peptide located within the following region: AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKH |
Rabbit Polyclonal Anti-DHRS4 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Dhrs4 antibody is: synthetic peptide directed towards the middle region of Mouse Dhrs4. Synthetic peptide located within the following region: RRLAEDGAHVVVSSRKQQNVDRAVATLQGEGLSVTGIVCHVGKAEDREKL |
Rabbit Polyclonal Anti-DGAT1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Dgat1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dgat1. Synthetic peptide located within the following region: HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A1,CYP1A2) antibody
Reactivities | Rat |
Immunogen | Cytochrome P450 (CYP1A1,CYP1A2) |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A1) antibody
Reactivities | Rat |
Immunogen | Cytochrome P450 (CYP1A1) |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A2) antibody
Reactivities | Human |
Immunogen | Cytochrome P450 (CYP1A2) |
Sheep polyclonal anti-Cytochrome P450 2A6 antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CYP 2A6 |
Sheep polyclonal anti-Cytochrome P450 3A4 antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CYP 3A4 |
Rabbit polyclonal anti-Cytochrome P450 (CYP3A4) antibody
Reactivities | Human |
Immunogen | Cytochrome P450 (CYP3A4) |
Anti-CYP1A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human cytochrome P450, family 1, subfamily A, polypeptide 1 |
Anti-ADH4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human alcohol dehydrogenase 4 (class II), pi polypeptide |