Germany
Japan
United Kingdom
China
Rabbit Polyclonal KEAP1 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Primary Antibodies
Download
Rabbit Polyclonal BRCA1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal CUL4B Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Antibody against MDM2 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Rabbit Polyclonal antibody to UBE2L3 (ubiquitin-conjugating enzyme E2L 3)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 92 and 154 of UBE2L3 (Uniprot ID#P68036) |
Rabbit polyclonal antibody to Cullin5 (cullin 5)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 113 and 583 of Cullin 5 (Uniprot ID#Q93034) |
Rabbit polyclonal Parkin Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Parkin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 111-140 amino acids from the N-terminal region of human Parkin. |
Rabbit Polyclonal XIAP (Ser87) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human XIAP around the phosphorylation site of Serine 87 |
| Modifications | Phospho-specific |
Rabbit anti-UBE2D1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UBE2D1 |
Rabbit anti-TCEB2 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TCEB2 |
Rabbit anti-PIAS2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PIAS2 |
Goat Polyclonal Antibody against SOCS3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PIREFLDQYDAPL, from the C Terminus of the protein sequence according to NP_003946.3. |
Rabbit Polyclonal cIAP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | c-IAP antibody was raised against a synthetic peptide corresponding to 14 amino acids at the C-terminus of human c-IAP1 c-IAP antibody detects both c-IAP1 and c-IAP2. |
Rabbit Polyclonal SOCS1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SOCS1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human SOCS1. |
Rabbit Polyclonal antibody to DDB1 (damage-specific DNA binding protein 1, 127kDa)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 749 and 1140 of DDB1 (Uniprot ID#Q16531) |
Rabbit polyclonal CDC16/APC6 (Ab-560) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
| Modifications | Phospho-specific |
FBXW7 / FBW7 Mouse Monoclonal (3D1) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-TRIM32 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKE |
Rabbit anti-SKP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SKP1 |
Rabbit anti-CUL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CUL5 |
Rabbit Polyclonal Anti-SLC38A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC38A4 antibody: synthetic peptide directed towards the middle region of human SLC38A4. Synthetic peptide located within the following region: LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV |
Rabbit Polyclonal Anti-UBA1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBA1 antibody: synthetic peptide directed towards the N terminal of human UBA1. Synthetic peptide located within the following region: MEAGPPGSARPAEPGPCLSGQRGADHTASASLQSVAGTEPGRHPQAVAAV |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE |
Rabbit Polyclonal Anti-MID1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MID1 antibody is: synthetic peptide directed towards the N-terminal region of Human MID1. Synthetic peptide located within the following region: PTCRHVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAF |
Rabbit Polyclonal Anti-UBE2K Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the middle region of human UBE2K. Synthetic peptide located within the following region: TVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPV |
Rabbit Polyclonal Anti-UBE2K Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the N terminal of human UBE2K. Synthetic peptide located within the following region: FTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNIS |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: VRRASGCLITLDQHNGKKSQAVESANTAHNGKVNGLCFTSDGLHLLTVGT |
Rabbit Polyclonal Anti-ERCC8 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the N terminal of human ERCC8. Synthetic peptide located within the following region: DLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSFD |
Rabbit Polyclonal Anti-KLHL9 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHL9 antibody: synthetic peptide directed towards the middle region of human KLHL9. Synthetic peptide located within the following region: SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY |
Rabbit Polyclonal Anti-PIAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the N terminal of human PIAS1. Synthetic peptide located within the following region: MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCS |
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the middle region of human SOCS1. Synthetic peptide located within the following region: RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA |
Rabbit Polyclonal Anti-MAP3K1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH |
Active filters
Conjugates
- Unconjugated
Pathways
- Ubiquitin mediated proteolysis
Filter by
Target Symbol
- MDM2 (76)
- UBE2E3 (57)
- BRCA1 (38)
- SOCS3 (37)
- FBXW7 (32)
- UBE2G2 (31)
- UBE2J1 (28)
- BIRC3 (27)
- UBE2D2 (26)
- SAE1 (24)
- MGRN1 (22)
- ANAPC11 (21)
- ERCC8 (20)
- UBE2S (20)
- ANAPC2 (19)
- BTRC (19)
- KEAP1 (18)
- NEDD4 (18)
- UBOX5 (18)
- PIAS2 (16)
- AIRE (15)
- CUL4B (13)
- UBA3 (13)
- SMURF2 (11)
- SOCS1 (11)
- CBLC (10)
- TTK (10)
- PML (9)
- VHL (9)
- PIAS1 (8)
- PRKN (8)
- TRAF6 (8)
- UBE3B (8)
- ANAPC1 (7)
- CBL (7)
- CDC16 (7)
- CUL3 (7)
- DDB1 (7)
- STUB1 (7)
- UBE2K (7)
- UBE2L3 (7)
- CDC20 (6)
- CDC23 (6)
- CDC27 (6)
- CUL2 (6)
- SIAH1 (6)
- SYVN1 (6)
- TRIM32 (6)
- UBA2 (6)
- UBA7 (6)
- UBE2D1 (6)
- UBE2I (6)
- XIAP (6)
- ANAPC10 (5)
- BIRC2 (5)
- BIRC6 (5)
- CUL1 (5)
- CUL4A (5)
- CUL5 (5)
- DDB2 (5)
- ITCH (5)
- PIAS3 (5)
- UBE2B (5)
- UBE2C (5)
- ANAPC5 (4)
- CDC34 (4)
- CUL7 (4)
- ELOC (4)
- FANCL (4)
- FBXW11 (4)
- MAP3K1 (4)
- MID1 (4)
- PIAS4 (4)
- UBA1 (4)
- UBE2D4 (4)
- UBE2E1 (4)
- UBE2M (4)
- UBE2N (4)
- UBR5 (4)
- WWP2 (4)
- ANAPC13 (3)
- ANAPC4 (3)
- CDC26 (3)
- COP1 (3)
- FBXO4 (3)
- HERC4 (3)
- SKP1 (3)
- SKP2 (3)
- UBA6 (3)
- UBE2L6 (3)
- ANAPC7 (2)
- CIAP2 (2)
- ELOB (2)
- FBXO2 (2)
- FBXW8 (2)
- KLHL9 (2)
- NEDD4L (2)
- PPIL2 (2)
- PRPF19 (2)
- RCHY1 (2)